KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4143Help
Entry
ECS88_4143        CDS       T00830                                 

Gene name
bglB
Definition
cryptic phospho-beta-glucosidase B (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecz00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4110775..4112169)
Genome map
AA seq 464 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWQEDGKGITTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEAEPNEAGLAFYERLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHAP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLIPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDPVGLRILLNTLWDRYQKPLFIV
ENGLGAKDSVEVDGSIQDDYRIAYLNDHLVQVNEAIADGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggtgcaacagctgccaatcaggtggaa
ggcgcctggcaggaagatggcaaagggatcacgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaatttttcctcagggcgatgaagccgaaccgaatgaa
gcggggttagcgttttacgagcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgggcggtcatcgatcacttcgagcattacgcacgcacggtctttacccgctac
caacataaagttgcgttatggctgacatttaatgaaatcaacatgtcattacacgcgcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggcgatccat
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgatccccgaagcg
aaaattggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggtcagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacataccgtagatttcatctcttttagttattac
atgaccggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatcccaaatccgcatctgaaaagttcagagtgggggtggcaaattgatccggtt
ggattacggattctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagtggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattgccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggtgaaggaagcctc
acaagaacgcgcaagaaaagcttcggatggtatgcagaagtgatcaaaactcgggggcta
tcattaaaaaaataa

DBGET integrated database retrieval system