KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4253Help
Entry
ECS88_4253        CDS       T00830                                 

Gene name
pldB
Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECS88_4253 (pldB)
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECS88_4253 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4220732..4221754
Genome map
AA seq 340 aa AA seqDB search
MFQQQKDWETRENAFAAFTMGPLTDFWRQRDEAEFTGVDDIPVRFVRFRAQHHDRVVVIC
PGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLGDPHLGHVNRFNDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAISTLFLQRHPGVCDAIALTAPMFGIVIRMPSFMARQI
LNWAEAHPRFRDGYAIGTGRWRALPFAINVLTHSRQRYRRNLRFYADDPTIRVGGPTYHW
VRESILAGEQVLAGAGDDATPTLLLQAEEERVVDNRMHDRFCELRTAAGHPVEGGRPLVI
KGAYHEILFEKDAMRSVALHAIVDFFNRHNSPSGNRSTEV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagcaaaaagactgggaaacaagagaaaacgcgtttgctgcttttaccatg
ggaccgctgactgatttctggcgtcagcgtgatgaagcagagtttactggtgtggatgac
attccggttcgctttgtccgttttcgcgcacagcaccatgaccgggtggtagtcatctgt
ccggggcgtattgagagctacgtaaaatatgcggaactggcctacgacctgttccatttg
gggtttgatgttttaatcatcgaccatcgcgggcagggacgttccggtcgcctgttaggc
gatccacatctcgggcatgttaatcgctttaatgattatgttgatgatctggcggcattc
tggcaacaggaggttcagcccggtccgtggcgtaaacgctatatactggcacattcgatg
ggcggtgcgatctccacattatttctgcaacgccatccaggtgtatgtgacgccattgcg
ctaactgcgccaatgtttgggattgtgattcgtatgccgtcatttatggcacggcagatc
ctcaattgggccgaagcgcatccacgtttccgtgatggctatgcgataggcaccgggcgc
tggcgcgcgttgccgtttgctatcaacgtactgacccacagcagacagcgatatcgacgt
aacttacgtttctatgctgatgacccaacgattcgcgtcggtgggccgacctaccattgg
gtacgcgaaagtattctggctggcgaacaggtgttagccggtgcgggtgatgacgccacg
ccaacgcttctcttacaagctgaagaggaacgcgtggtggataaccgcatgcacgaccgt
ttttgtgaactacgcaccgctgcgggccatcctgtcgaaggaggacggccgttggtaatt
aaaggtgcgtaccatgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccac
gctatcgttgattttttcaacaggcataactcacccagcggaaaccgctctacagaggtt
taa

DBGET integrated database retrieval system