KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4294Help
Entry
ECS88_4294        CDS       T00830                                 

Gene name
fadB
Definition
(GenBank) fused 3-hydroxybutyryl-CoA epimerase and delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase and enoyl-CoA hydratase; 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00071  Fatty acid degradation
ecz00280  Valine, leucine and isoleucine degradation
ecz00281  Geraniol degradation
ecz00310  Lysine degradation
ecz00362  Benzoate degradation
ecz00380  Tryptophan metabolism
ecz00410  beta-Alanine metabolism
ecz00640  Propanoate metabolism
ecz00650  Butanoate metabolism
ecz00903  Limonene and pinene degradation
ecz00930  Caprolactam degradation
ecz01040  Biosynthesis of unsaturated fatty acids
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
ecz01212  Fatty acid metabolism
Module
ecz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECS88_4294 (fadB)
   00650 Butanoate metabolism
    ECS88_4294 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ECS88_4294 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ECS88_4294 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECS88_4294 (fadB)
   00310 Lysine degradation
    ECS88_4294 (fadB)
   00380 Tryptophan metabolism
    ECS88_4294 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECS88_4294 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ECS88_4294 (fadB)
   00281 Geraniol degradation
    ECS88_4294 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECS88_4294 (fadB)
   00930 Caprolactam degradation
    ECS88_4294 (fadB)
Enzymes [BR:ecz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ECS88_4294 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ECS88_4294 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ECS88_4294 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ECS88_4294 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CAR05485
UniProt: B7MHD1
Position
complement(4261679..4263868)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAIAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGAGFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDVVVDDLLAKVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctttaccttgactggctggaagatggcattgccgaactg
gtatttgataccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaaggactgctgctacgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaattgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggggcgatagcgatt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccgctaaaactgagcaagattgaagccgccatgagcttcaccatcgctaaagggatggtc
gcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggtaaagcgaagaaactcaccaaagatgttgaaaccccgaaacaggccgctgtgctgggc
gcaggcattatgggcggcggcatcgcctaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
attcacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gttgaaaacccgaaagtgaaaaaagccgtgctggcagaaaccgagcagaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatgccgttg
gtggaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagtcgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggtcaacgactgccccggcttcttcgtcaac
cgtgtgctgttcccctatttcgccggtttcagccagttgctgcgcgacggcgcgggtttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggcatatctg
ctggatgttgtgggcattgacaccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattatcgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagatgtcgtcgttgacgacctgctggcaaaagtgagccagccgaagcgc
gatttcagcgaggaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtc
cgctgtctggaagagggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggcagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtaccg
gaaggtctgcgtaataaagcacgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system