KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4538Help
Entry
ECS88_4538        CDS       T00830                                 

Gene name
sucD
Definition
(RefSeq) Succinyl-CoA synthetase alpha chain (SCS-alpha) (EC:6.2.1.4)
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECS88_4538 (sucD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECS88_4538 (sucD)
   00640 Propanoate metabolism
    ECS88_4538 (sucD)
   00660 C5-Branched dibasic acid metabolism
    ECS88_4538 (sucD)
Enzymes [BR:ecz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECS88_4538 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
4517912..4518784
Genome map
AA seq 290 aa AA seqDB search
MSVLINKHTRVLVQGITGKNGTFHTEQAIAYGTQIVGGVTPGKGGQRHLDRPVFDSMKEA
MRQTEADASVIYVPAPFVLDSVVEAIEAGVKLVVVITEGVPTLDMVKVRRLLDCHPDVRL
IGPNCPGVITPGECKIGIMPGEIHRPGRIGIVSRSGTLTYEAVAQTTALGLGQSTCIGIG
GDPVPGTNFIDALRLFENDPQTDAVIMIGEIGGNAEERAAEFIRHEMNKPVVGYIAGVTA
PKGKRMGHAGAIISGGSGSAEDKFRAFDKAGMAWTRNPALLGETLWNVIK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttttgatcaacaaacacacgcgggtactggtgcagggcattaccggcaaaaac
ggcacatttcatacagagcaggctattgcgtatggcacgcagattgtgggtggagtgacg
ccaggtaagggcgggcaacggcatctggatcgcccggtttttgattcaatgaaagaagcg
atgcgacaaactgaggctgatgccagcgtgatttatgtgcctgcaccgtttgtgctggat
tctgttgttgaggctattgaagctggcgtcaaattggttgtggtgatcactgaaggtgta
ccgacactggatatggtgaaagttcgtcggctgcttgactgccacccggatgtgcggctg
attgggccaaactgcccaggagttatcacgccgggcgagtgcaaaatcgggattatgcct
ggtgaaatccaccgcccagggcgtattgggattgtttcccgctccggtacattaacctac
gaagctgtagcgcaaaccacggcgctgggacttgggcaatccacctgtattggtattggc
ggcgatccggttccggggactaactttattgatgcgctgcgtttattcgaaaatgatccg
caaacagacgcggtaattatgatcggtgaaattggtggtaatgcggaagaacgggctgcg
gaatttattcgtcatgaaatgaataaaccggtcgtaggttatattgccggtgttactgca
ccaaaaggaaaacgcatggggcacgccggagccattatttctggcggtagcggcagtgca
gaggataaattccgtgcgttcgataaagcaggcatggcatggacaagaaacccggcgttg
cttggcgaaacgttatggaatgttattaagtaa

DBGET integrated database retrieval system