KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4562Help
Entry
ECS88_4562        CDS       T00830                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
ecz00010  Glycolysis / Gluconeogenesis
ecz00620  Pyruvate metabolism
ecz00640  Propanoate metabolism
ecz00680  Methane metabolism
ecz01100  Metabolic pathways
ecz01110  Biosynthesis of secondary metabolites
ecz01120  Microbial metabolism in diverse environments
ecz01130  Biosynthesis of antibiotics
ecz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECS88_4562 (acs)
   00620 Pyruvate metabolism
    ECS88_4562 (acs)
   00640 Propanoate metabolism
    ECS88_4562 (acs)
  Energy metabolism
   00680 Methane metabolism
    ECS88_4562 (acs)
Enzymes [BR:ecz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECS88_4562 (acs)
Lipid biosynthesis proteins [BR:ecz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECS88_4562 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAR05720
UniProt: B7MJT7
Position
complement(4541638..4543596)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcacaccgtaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatattagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgaactgggcattaaaaaaggtgacgtagttgcgatttatatgccg
atggtaccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtacattcg
gtgattttcggcggcttctcgccggaagccgttgccggacgcattatcgactccagttca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcggaaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagccagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggtaagccaaaaggcgtgctgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgacatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtatggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaag
aagatcggcaatgagaaatgcccggtggtcgacacctggtggcagaccgaaactggcggt
ttcatgatcacgccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccagcgctggtcgataacgaaggtaacccgctggagggggccacc
gaaggcagtctggtgatcaccgactcctggccgggtcaggcgcgtactctgtttggcgat
cacgaacgttttgagcagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgcgtggacgacgtgctg
aacgtctccggtcaccgcctggggacggcagagattgagtcggcgctggtggcgcatccg
aaaattgccgaagccgctgtggtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggccatcgcgatgccatcgtaa

DBGET integrated database retrieval system