KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_4835Help
Entry
ECS88_4835        CDS       T00830                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ecz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECS88_4835 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECS88_4835 (pyrB)
Enzymes [BR:ecz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ECS88_4835 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4800894..4801829)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKF
DGNRFYFIAPDALAMPQYILDMLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQAL
LALVLNRDLVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgctatatcagaaacatatcatttccataaacgaccttagtcgcgatgac
cttaatctggtgctggcgacagcggcgaaactgaaagcaaacccgcaaccagagctgttg
aagcacaaagtcattgccagctgtttcttcgaagcctctacccgtacccgcctctctttc
gaaacttccatgcaccgcctgggtgccagcgtggtgggcttctccgacagcgccaataca
tcactgggtaaaaagggcgaaacgctggccgataccatttcggttatcagcacttacgtc
gatgcgatagtgatgcgtcatccgcaggaaggtgcggcgcgcctggccaccgagttttcc
ggcaatgtaccggtactgaatgccggtgatggctccaaccaacatccgacgcaaaccttg
ctggacttattcactattcaggaaacccaggggcgtctggacaatctccacgtcgcaatg
gttggtgacctgaaatatggccgcaccgttcactccctgactcaggcgttagcgaagttc
gacggcaaccgtttttacttcatcgcgccggacgcgctggcaatgccgcaatacattctg
gatatgctcgatgaaaaagggatcgcatggagtctgcacagctctattgaagaagtgatg
gcggaagtagacatcctgtacatgacccgcgtgcaaaaagagcgtctggacccgtccgag
tacgccaacgtgaaagcgcagtttgttcttcgcgccagcgatctccacaacgccaaagcc
aatatgaaagtgctgcatccgctgccgcgtgttgatgagattgccaccgatgtggataaa
acgccacacgcctggtacttccagcaggcaggcaacgggattttcgctcgccaggcgtta
ctggcactggttctgaatcgcgatctggtactgtaa

DBGET integrated database retrieval system