KEGG   Escherichia coli O45 K1 H7 S88 (ExPEC): ECS88_5020Help
Entry
ECS88_5020        CDS       T00830                                 

Gene name
ydfQ
Definition
membrane-associated lysozyme; Qin prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecz  Escherichia coli O45:K1:H7 S88 (ExPEC)
Brite
Enzymes [BR:ecz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECS88_5020 (ydfQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4970968..4971501
Genome map
AA seq 177 aa AA seqDB search
MNVKIRYSLSAAVLALIAASAPAPDILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCAQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaaaatcagatacagcctgtcggctgctgttctggcactgattgccgccagt
gctcctgcccctgacattctcgatcagtttctggatgaaaaagaggggaatcacaccact
gcataccgcgatggctccggcatatggaccatctgtcggggagcaacgatggtggacggt
aaacctgttattccgggaatgaaactgtcgaaggaaaaatgcgcccaggttaacgccatt
gagcgggataaggcgctggcatgggtggagcgcaatataaaagttccactgaccgagcca
cagaaagccggtatcgcgtcattctgtccctataacattggccctggtaagtgttttccg
tcgacgttttataagcggcttaatgccggtgatcgtaaaggcgcatgcgaggcgattcgc
tggtggataaaggacggtggacgtgattgccgcattcgttcaaataattgttacggtcag
gttattcgtcgtgaccaggagagtgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system