KEGG   Escherichia coli DH1: EcDH1_0297Help
Entry
EcDH1_0297        CDS       T01996                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
edh  Escherichia coli DH1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcDH1_0297
Enzymes [BR:edh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EcDH1_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
333694..335778
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TSGKKMPMVVEGSGEYSWLLTTEEGTQYKGHVTGGKAFNLPTKLPEGYHTLTLTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLVDVAKRGGS
FIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEAQAWWQLPTTQQT
LQQARDADWVDYSTVTALKMTALRMAWKGFAQRDDEQMAAFRQFVAEQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQGYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFENDHEKTFRAPKAYPEQS
MAVAATHDLPTLRGYWECGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKYGCL
PKRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWLDMAEPVNIPGTSYQYKNWR
RKLSATLESMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcggggattagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacgccagtcccgaatgtcatggtttat
accagcggcaaaaaaatgccgatggtggtggagggcagcggcgaatatagctggctgctg
accaccgaagaaggaacgcagtacaaaggccatgtaacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgacactcacccaggacgaccagcgcgcg
cattgccgggtgattgtcgccccgaaacgctgttacgaaccgcaggcgttgctgaataaa
caaaagctgtggggtgcctgcgttcagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgctggtggatgtggcaaaacgtggcgggtcg
ttcattggcctgaacccgattcatgcgctctatccggcaaatccggagagcgccagccca
tacagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgccgttgaa
gatttccatcttagcgaagaggctcaggcctggtggcagttgccgaccacgcaacagacg
ctgcaacaggcgcgcgatgccgactgggtcgattactccacggttaccgccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgagcagatggccgcg
tttcgccagtttgttgcagagcagggcgacagcctgttctggcaggcagcctttgatgcg
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggcctgcatggccagag
atgtatcagaacgtggattcaccagaagtgcgtcagttctgcgaagaacatcgtgatgac
gtcgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccagggctatgaaatgccgattggcttgtatcgtgatctggcggttggcgtagcg
gaaggtggggcggaaacctggtgtgaccgtgaactatattgcctgaaagcatcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattaccgccaatggacccg
catatcatcaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgaccatgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcagatcagggcgcgtatgttcactatccggtggatgatctgctctcg
attctggcactcgaaagtaaacgtcatcgctgtatggtgattggtgaagatctcggtacc
gtaccggtagagattgtcggtaagctgcgcagcagcggtgtgtactcttacaaagtgctc
tatttcgaaaacgaccacgagaagacgttccgtgcaccgaaagcgtatccggagcagtcg
atggcggttgcggcgacacatgacctgccaacgctgcgcggttactgggagtgcggggat
ctaacgctgggcaaaaccctggggctgtatccggatgaagtggtactgcgcggtctgtat
caggatcgcgaactggcgaagcaagggctgctggatgcactgcataaatatggttgtctg
ccgaaacgtgccgggcataaggcatcgttgatgtcgatgacgccgacgctgaaccgtggt
ttgcagcgctacattgccgacagtaacagtgctctgttaggactacagccggaagactgg
ctggatatggccgaaccggtgaatattcctggcaccagttaccagtataaaaactggcga
cgcaagctttccgcaacgcttgagtcgatgtttgccgatgatggcgtgaacaagttgctg
aaggatttggacagacggcgcagagctgcagcgaagaagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system