KEGG   Escherichia coli DH1: EcDH1_0530Help
Entry
EcDH1_0530        CDS       T01996                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
edh  Escherichia coli DH1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EcDH1_0530
Enzymes [BR:edh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EcDH1_0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
558853..559701
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctttgcccagggtacttcactggaccttagccatcctcacgtaatggggatc
ctcaacgtcacgcctgattccttttcggatggtggcacgcataactcgctgatagatgcg
gtgaaacatgcgaatctgatgatcaacgctggcgcgacgatcattgacgttggtggcgag
tccacgcgcccaggggcggcggaagttagcgttgaagaagagttgcaacgtgttattcct
gtggttgaggcaattgctcaacgcttcgaagtctggatctcagtcgatacatccaaacca
gaagtcatccgtgagtcagcgaaagttggcgctcacattattaatgatatccgctccctt
tccgaacctggcgctctggaggcggctgcagaaaccggtttaccggtttgtctgatgcat
atgcagggaaatccaaaaaccatgcaggaagctccgaagtatgacgatgtctttgcagaa
gtgaatcgctactttattgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagag
aaattgttgctcgaccccggattcggtttcggtaaaaatctctcccataactattcatta
ctggcgcgcctggctgaatttcaccatttcaacctgccgctgttggtgggtatgtcacga
aaatcgatgattgggcagctgctgaacgtggggccgtccgagcgcctgagcggtagtctg
gcctgtgcggtcattgccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaa
gaaaccgtagaagcgatgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system