KEGG   Escherichia coli DH1: EcDH1_0721Help
Entry
EcDH1_0721        CDS       T01996                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
edh  Escherichia coli DH1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcDH1_0721
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcDH1_0721
   00630 Glyoxylate and dicarboxylate metabolism
    EcDH1_0721
Enzymes [BR:edh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EcDH1_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Structure
PDB: 

Jmol
Position
759958..762129
Genome map
AA seq 723 aa AA seqDB search
MSQTITQSRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRHYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASL
ENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagagccgtttacgcattgacgccaattttaaacgttttgtg
gatgaagaagttttaccgggaacagggctggacgctgcggcgttctggcgcaattttgat
gagatcgttcatgatctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcagcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccgcaaccggagcgcgtgacggtg
gaaaccacgggcattgacagcgaaatcaccagccaggcggggccgcagctggtggttccg
gcaatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
caacgcggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatctctaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggttgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtactccagcacagtttgtcggttaccgt
ggcgatgccgctgcgccgacctgcattttgctgaaaaataacggcctgcatattgagctg
caaatcgatgccaatgggcggattggcaaagacgatccggcgcacatcaacgatgttatc
gtcgaagctgctatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggagaaaaacggtcggcaaatcgtgcgtaaactgaatgacgatcgtcattacacc
gccgccgatggctctgaaatttctctgcacggacgctcgctgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgtcggacctcgctgaacttgcgtagctgtatcgct
caggcgcgcaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaatcagatgaaatcgacgcct
tggatcaaagcctacgagcgtaataacgtgctttccggtctgttctgtgggctgcgcggt
aaagcgcaaattggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcaccaaccgct
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtacaagccaacatt
gcccagaccgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gttgctgaaaacgctaactggtcggcgcaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgctgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaatgtggcgttgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacggtattctgaccaaagaacaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
gcggggaatttcgctaactcgtgtgcttttaaagctgccagcgatttaatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcctggcgtttacgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system