KEGG   Escherichia coli DH1: EcDH1_0945Help
Entry
EcDH1_0945        CDS       T01996                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
edh  Escherichia coli DH1
Brite
Enzymes [BR:edh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     EcDH1_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1014244..1014870
Genome map
AA seq 208 aa AA seqDB search
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcagacgcgtacaagcacttctggatcaattacgtgcgcaaggtattcaggat
gagcaggtgctgaatgcacttgccgccgtgccgcgtgaaaaattcgttgatgaagcgttt
gaacaaaaagcctgggacaatatcgctttgccgataggtcaggggcagacaatttcgcag
ccatatatggtggcgcgaatgaccgaattactcgagctgacgccgcagtcgcgggtgctg
gaaattggcaccggttcgggatatcaaacggcaatcctggcgcatcttgtccagcatgtt
tgctcggttgaacggattaaaggcttgcagtggcaggcacgtcgccgcctgaaaaatctt
gatttacataatgtttcaacccgtcatggcgatggatggcaaggttggcaggcacgtgcg
ccgtttgacgctatcattgttacggcggcaccgccggaaattccaactgcgctaatgacg
cagctggacgaaggcgggattctcgtcttacccgtaggggaggagcaccagtatttgaaa
cgggtgcgtcgtcggggaggcgaatttattatcgataccgtggaggccgtgcgctttgtc
cctttagtgaagggtgagctggcttaa

DBGET integrated database retrieval system