KEGG   Escherichia coli DH1: EcDH1_1615Help
Entry
EcDH1_1615        CDS       T01996                                 

Definition
regulatory protein GalF (EC:4.1.2.13)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
edh  Escherichia coli DH1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:edh00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:edh00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:edh00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:edh00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763729..1764622
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtctcgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccaatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgagttagaatcactccttgagcagcgc
gtgaagcgtcaactgctggcggaagtacagtccatctgtccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttaggccactccattttgtgtgcgcgacctgcc
attggtgacaacccatttgtcgtggtactgccagacgttgtgatcgacgatgccagcgcc
gacccgctacgttacaaccttgctgccatgattgcacgtttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagactaaa
gagccgctggaccgtgagggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgtaggtcgctatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gctattgccgagctggcgaaaaaacaatccgttgatgcaatgctgatgaccggcgacagt
tacgactgcggcaaaaaaatgggctatatgcaggcgtttgtgaagtatggcctacgcaac
ctgaaagaaggggcgaagttccgtaaaggtattgagaagctgttaagcgaataa

DBGET integrated database retrieval system