KEGG   Escherichia coli DH1: EcDH1_1637Help
Entry
EcDH1_1637        CDS       T01996                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
edh  Escherichia coli DH1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:edh01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:edh00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1785654..1786958)
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKARGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPASIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPAADMARRVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatttccgcctctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgcagaggagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgtccggtagcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgagtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtacggaatctgtg
ccaaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcgaaacgtcag
gtgagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctctctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgctgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaaccgcccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgtgaactggtcgat
agcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgttctaccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaagcgcatgaccgtacaggaactgtcgaaagaggggttc
tccgcgctggcttcaaccatagaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system