KEGG   Escherichia coli DH1: EcDH1_1779Help
Entry
EcDH1_1779        CDS       T01996                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
edh  Escherichia coli DH1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:edh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EcDH1_1779
Enzymes [BR:edh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EcDH1_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
1931303..1931914
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagagcgcacattgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggcgctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtgggggcactggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacgtctcctgccagcccggcgaccgacgatgctgaa
caagaagcggttgccgcgctggtggcgctgggctataaaccacaagaagcaagccgcatg
gtgagcaaaatcgctcgccctgacgccagcagtgaaactttaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system