KEGG   Escherichia coli DH1: EcDH1_2090Help
Entry
EcDH1_2090        CDS       T01996                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
edh  Escherichia coli DH1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2238421..2238954
Genome map
AA seq 177 aa AA seqDB search
MNTKIRYGLSAAVLALIGAGASAPQILDQFLDEKEGNHTMAYRDGSGIWTICRGATVVDG
KTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgctggc
gcatctgctcctcagatacttgaccagtttctggacgaaaaagaaggtaaccacacaatg
gcataccgcgatggttctggcatatggaccatctgtcggggtgccacagtggtggatgga
aaaaccgtttttcccaatatgaaactgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
caaaaagcgggtatcgcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgctggtgatcgtaaaggtgcatgcgaagcgattcgc
tggtggattaaggatggcggacgcgattgccgcattcgttcaaataactgttacggtcag
gttattcgtcgtgaccaggagagcgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system