KEGG   Escherichia coli DH1: EcDH1_2252Help
Entry
EcDH1_2252        CDS       T01996                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
edh  Escherichia coli DH1
Pathway
edh00071  Fatty acid degradation
edh00280  Valine, leucine and isoleucine degradation
edh00281  Geraniol degradation
edh00310  Lysine degradation
edh00360  Phenylalanine metabolism
edh00362  Benzoate degradation
edh00380  Tryptophan metabolism
edh00410  beta-Alanine metabolism
edh00627  Aminobenzoate degradation
edh00640  Propanoate metabolism
edh00650  Butanoate metabolism
edh00903  Limonene and pinene degradation
edh00930  Caprolactam degradation
edh01100  Metabolic pathways
edh01110  Biosynthesis of secondary metabolites
edh01120  Microbial metabolism in diverse environments
edh01130  Biosynthesis of antibiotics
edh01212  Fatty acid metabolism
Module
edh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcDH1_2252
   00650 Butanoate metabolism
    EcDH1_2252
  Lipid metabolism
   00071 Fatty acid degradation
    EcDH1_2252
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcDH1_2252
   00310 Lysine degradation
    EcDH1_2252
   00360 Phenylalanine metabolism
    EcDH1_2252
   00380 Tryptophan metabolism
    EcDH1_2252
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcDH1_2252
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcDH1_2252
   00281 Geraniol degradation
    EcDH1_2252
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcDH1_2252
   00627 Aminobenzoate degradation
    EcDH1_2252
   00930 Caprolactam degradation
    EcDH1_2252
Enzymes [BR:edh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcDH1_2252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACX39900
JGI: EcDH12252
Structure
PDB: 

Jmol
Position
complement(2420214..2420981)
Genome map
AA seq 255 aa AA seqDB search
MSELIVSRQQRVLLLTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFA
AGADLNEMAEKDLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAG
ENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPS
DLTLEYALQLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEG
ISAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgatcgtcagccgtcagcaacgagtattgttgctgacccttaaccgtccc
gccgcacgtaatgcgctaaataatgccctgctgatgcaactggtaaatgaactggaagct
gcggctaccgataccagcatttcggtctgtgtgattaccggtaatgcacgcttttttgcc
gctggggccgatctcaacgaaatggcagaaaaagatctcgcggccaccttaaacgataca
cgtccgcagctatgggcgcgattgcaggcctttaataaaccacttatcgcagccgtcaat
ggttacgcgcttggggcgggttgcgaactggcattgttgtgcgatgtggtggttgccgga
gagaacgcgcgttttgggttgccggaaatcactctcggcatcatgcctggcgcaggcgga
acgcaacgtttaatccgtagtgtcggtaaatcgttagccagcaaaatggtgctgagcgga
gaaagtatcaccgctcagcaagcacagcaggccgggctggttagcgacgtcttccccagc
gatttaaccctcgaatacgccttacagctggcatcgaaaatggcacgtcactcgccgctg
gccttacaagcggcaaagcaagcgctgcgccagtcgcaggaagtggctttgcaagccgga
cttgcccaggagcgacagttattcaccttgctggcggcaacagaagatcgtcatgaaggc
atctccgctttcttacaaaaacgcacgcccgactttaaaggacgctaa

DBGET integrated database retrieval system