KEGG   Escherichia coli DH1: EcDH1_2413Help
Entry
EcDH1_2413        CDS       T01996                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
edh  Escherichia coli DH1
Pathway
edh00040  Pentose and glucuronate interconversions
edh00052  Galactose metabolism
edh00500  Starch and sucrose metabolism
edh00520  Amino sugar and nucleotide sugar metabolism
edh01100  Metabolic pathways
edh01130  Biosynthesis of antibiotics
Module
edh_M00362  Nucleotide sugar biosynthesis, prokaryotes
edh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcDH1_2413
   00052 Galactose metabolism
    EcDH1_2413
   00500 Starch and sucrose metabolism
    EcDH1_2413
   00520 Amino sugar and nucleotide sugar metabolism
    EcDH1_2413
Enzymes [BR:edh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcDH1_2413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACX40055
JGI: EcDH12413
Structure
PDB: 

Jmol
Position
complement(2586113..2587021)
Genome map
AA seq 302 aa AA seqDB search
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaatacgaaagtcaaaaaagccgttatccccgttgcgggattaggaacc
aggatgttgccggcgacgaaagccatcccgaaagagatgctgccacttgtcgataagcca
ttaattcaatacgtcgtgaatgaatgtattgcggctggcattactgaaattgtgctggtt
acacactcatctaaaaactctattgaaaaccactttgataccagttttgaactggaagca
atgctggaaaaacgtgtaaaacgtcaactgcttgatgaagtgcagtctatttgtccaccg
cacgtgactattatgcaagttcgtcagggtctggcgaaaggcctgggacacgcggtattg
tgtgctcacccggtagtgggtgatgaaccggtagctgttattttgcctgatgttattctg
gatgaatatgaatccgatttgtcacaggataacctggcagagatgatccgccgctttgat
gaaacgggtcatagccagatcatggttgaaccggttgctgatgtgaccgcatatggcgtt
gtggattgcaaaggcgttgaattagcgccgggtgaaagcgtaccgatggttggtgtggta
gaaaaaccgaaagcggatgttgcgccgtctaatctcgctattgtgggtcgttacgtactt
agcgcggatatttggccgttgctggcaaaaacccctccgggagctggtgatgaaattcag
ctcaccgacgcaattgatatgctgatcgaaaaagaaacggtggaagcctatcatatgaaa
gggaagagccatgactgcggtaataaattaggttacatgcaggccttcgttgaatacggt
attcgtcataacacccttggcacggaatttaaagcctggcttgaagaagagatgggcatt
aagaagtaa

DBGET integrated database retrieval system