KEGG   Escherichia coli DH1: EcDH1_2887Help
Entry
EcDH1_2887        CDS       T01996                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
edh  Escherichia coli DH1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcDH1_2887
   01230 Biosynthesis of amino acids
    EcDH1_2887
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcDH1_2887
  Energy metabolism
   00680 Methane metabolism
    EcDH1_2887
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcDH1_2887
Enzymes [BR:edh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EcDH1_2887
Exosome [BR:edh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EcDH1_2887
  Exosomal proteins of melanoma cells
   EcDH1_2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
3093524..3094276
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system