KEGG   Escherichia coli DH1: EcDH1_3116Help
Entry
EcDH1_3116        CDS       T01996                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
edh  Escherichia coli DH1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    EcDH1_3116
Enzymes [BR:edh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EcDH1_3116
   3.1.2  Thioester hydrolases
    3.1.2.-  
     EcDH1_3116
Lipid biosynthesis proteins [BR:edh01004]
 Fatty acid synthase
  Component type
   EcDH1_3116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
3351223..3351816
Genome map
AA seq 197 aa AA seqDB search
MPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGD
TSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLM
QIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPF
IADWMAKQLQPLVNHDS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcctgttcctggtcctgttaaccttccgtgccgccgcagcggacacgttattg
attctgggtgatagcctgagcgccgggtatcgaatgtctgccagcgcggcctggcctgcc
ttgttgaatgataagtggcagagtaaaacgtcggtagttaatgccagcatcagcggcgac
acctcgcaacaaggactggcgcgccttccggctctgctgaaacagcatcagccgcgttgg
gtgctggttgaactgggcggcaatgacggtttgcgtggttttcagccacagcaaaccgag
caaacgctgcgccagattttgcaggatgtcaaagccgccaacgctgaaccattgttaatg
caaatacgtctgcctgcaaactatggtcgccgttataatgaagcctttagcgccatttac
cccaaactcgccaaagagtttgatgttccgctgctgcccttttttatggaagaggtctac
ctcaagccacaatggatgcaggatgacggtattcatcccaaccgcgacgcccagccgttt
attgccgactggatggcgaagcagttgcagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system