KEGG   Escherichia coli DH1: EcDH1_3405Help
Entry
EcDH1_3405        CDS       T01996                                 

Definition
lipoprotein
Orthology
K02073  
D-methionine transport system substrate-binding protein
Organism
edh  Escherichia coli DH1
Pathway
ABC transporters
Module
D-Methionine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:edh02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3650450..3651265
Genome map
AA seq 271 aa AA seqDB search
MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQVAEVAQKVAKDKYGLD
VELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLVAVGNTFVYPIAGYSKK
IKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGLLPTVLDVVENPKNLKIV
ELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVEDKESPYVNLIVTREDNKDA
ENVKKFVQAYQSDEVYEAANKVFNGGAVKGW
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaaattcaaaacctttgcggcagtgggagccctgatcggatcactggcactg
gtaggctgcggtcaggatgaaaaagatccaaaccacattaaagtcggcgtgattgttggt
gccgaacagcaggttgcagaagtcgcgcagaaagttgcgaaagacaaatatggcctggac
gttgagctggtaaccttcaacgactatgttctgccaaacgaagcattgagcaaaggcgat
atcgacgccaacgccttccagcataaaccgtaccttgatcagcaactgaaagatcgtggc
tacaaactggtcgcagtaggcaacacttttgtttatccgattgctggttactccaagaaa
atcaaatcactggatgaactgcaggatggttcgcaggttgccgtgccaaacgacccaact
aaccttggtcgttcactgctgctgctgcaaaaagtgggcttgatcaaactgaaagatggc
gttggcctgctgccgaccgttcttgatgttgttgagaaccccaaaaatctgaaaattgtt
gaactggaagcaccgcaactgccgcgttctctggacgacgcgcaaatcgctctggcagtt
atcaataccacctatgccagccagattggcctgactccggcgaaagacggtatctttgtt
gaagataaagagtccccgtacgtaaacctgatcgtgacgcgtgaagataacaaagacgcc
gagaacgtgaagaaattcgtccaggcttatcagtctgacgaagtttacgaagcagcaaac
aaagtgtttaacggcggagctgttaaaggctggtaa

DBGET integrated database retrieval system