KEGG   Escherichia coli DH1: EcDH1_4059Help
Entry
EcDH1_4059        CDS       T01996                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
edh  Escherichia coli DH1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EcDH1_4059
Enzymes [BR:edh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EcDH1_4059
Exosome [BR:edh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcDH1_4059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
4397248..4398756
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSST
LVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDG
LEDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYAGWKKAVKRAMAWEEHDE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggcaccaccagctcccgcgcggtc
gtaatggatcacgatgccaatatcattagcgtgtcgcagcgcgaatttgagcaaatctac
ccaaaaccaggttgggtagaacacgacccaatggaaatctgggccacccaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagttccgatcaaattgcagctatcggtatt
acgaaccagcgtgaaaccactattgtctgggaaaaagaaaccggcaagcctatctataac
gccattgtctggcagtgccgtcgtaccgcagaaatctgcgagcatttaaaacgtgacggt
ttagaagattatatccgcagcaataccggtctggtgattgacccgtacttttctggcacc
aaagtgaagtggatcctcgaccatgtggaaggctctcgcgagcgtgcacgtcgtggtgaa
ttgctgtttggtacggttgatacgtggcttatctggaaaatgactcagggccgtgtccat
gtgaccgattacaccaacgcctctcgtaccatgttgttcaacatccataccctggactgg
gacgacaaaatgctggaagtgctggatattccgcgcgagatgctgccagaagtgcgtcgt
tcttccgaagtatacggtcagactaacattggcggcaaaggcggcacgcgtattccaatc
tccgggatcgccggtgaccagcaggccgcgctgtttggtcagttgtgcgtgaaagaaggg
atggcgaagaacacctatggcactggctgctttatgctgatgaacactggcgagaaagcg
gtgaaatcagaaaacggcctgctgaccaccatcgcctgcggcccgactggcgaagtgaac
tatgcgttggaaggtgcggtgtttatggcaggcgcatccattcagtggctgcgcgatgaa
atgaagttgattaacgacgcctacgattccgaatatttcgccaccaaagtgcaaaacacc
aatggtgtgtatgtggttccggcatttaccgggctgggtgcgccgtactgggacccgtat
gcgcgcggggcgattttcggtctgactcgtggggtgaacgctaaccacattatacgcgcg
acgctggagtctattgcttatcagacgcgtgacgtgctggaagcgatgcaggccgactct
ggtatccgtctgcacgccctgcgcgtggatggtggcgcagtagcaaacaatttcctgatg
cagttccagtccgatattctcggcacccgcgttgagcgcccggaagtgcgcgaagtcacc
gcattgggtgcggcctatctcgcaggcctggcggttggcttctggcagaacctcgacgag
ctgcaagagaaagcggtgattgagcgcgagttccgtccaggcatcgaaaccactgagcgt
aattaccgttacgcaggctggaaaaaagcggttaaacgcgcgatggcgtgggaagaacac
gacgaataa

DBGET integrated database retrieval system