KEGG   Escherichia coli DH1: EcDH1_4066Help
Entry
EcDH1_4066        CDS       T01996                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
edh  Escherichia coli DH1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcDH1_4066
   01230 Biosynthesis of amino acids
    EcDH1_4066
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcDH1_4066
   00051 Fructose and mannose metabolism
    EcDH1_4066
   00562 Inositol phosphate metabolism
    EcDH1_4066
Enzymes [BR:edh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EcDH1_4066
Exosome [BR:edh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EcDH1_4066
  Exosomal proteins of bladder cancer cells
   EcDH1_4066
  Exosomal proteins of melanoma cells
   EcDH1_4066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
4402963..4403730
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtatatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaatgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccggatatcgacggcgcgctggttggtggtgcttctctgaaagctgac
gccttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system