KEGG   Entamoeba dispar: EDI_000710Help
Entry
EDI_000710        CDS       T01083                                 

Definition
protein disulfide-isomerase precursor (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
edi  Entamoeba dispar
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EDI_000710
Enzymes [BR:edi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EDI_000710
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EDI_000710
  Exosomal proteins of colorectal cancer cells
   EDI_000710
  Exosomal proteins of bladder cancer cells
   EDI_000710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 512 aa AA seqDB search
MMKIFFFITLLSIVFAEADNAAQEDKRPFEIFTLNNNFYGNFIDHEDIVFVKYYAPWCGH
CKALKPIYENLAKELHNKLKFAEVNCEESKEICEKEGIEGYPTLALFRKGRSKKVYGGER
NLEAMKNFLENASLPPIIESTKEEIEELKKKENSFVIIKSEADDQIRNKLVELVDELDYL
HFYALNTEMDNFELAVYNGDSKEMFTYEITTLDKFNGIEFIDWANTKTFPLFHQVNMPLF
RRIENLPVYTLWYFYQGTIPKVHEDLFRGLAKKYNGKFIFFSFNKIISEDQVKHMHHTGN
VYPVISIIHTNKRNMYVMDEDVTIDEETINNYIESILNGTAQLYYQSSDPIKPEDQKDVF
KLTGHNFNEFVTTKGKDSLVIFCVERADMCKYFLTTPLAKVAKRMQGIDTFQMAWIDAST
DDISPEWNLNIIPKVYLVSEKDGETKKVEMNEMPSEENTMKFIMENALFKFEMPAPLPEE
NKEDESPESDSDSEEAEKKEDVIEKPQEKKEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatcttctttttcattacccttttatctattgtatttgctgaagctgataat
gcagctcaagaagacaaaagaccatttgaaatattcacattaaacaataacttttatgga
aatttcattgaccatgaagacattgtttttgtaaaatattatgcaccatggtgtggtcat
tgcaaagcattaaaaccaatttatgaaaatcttgctaaagaactacacaataaattaaaa
tttgctgaagtaaattgtgaagaatcaaaggaaatttgtgagaaagaaggaattgaagga
tatccaacattagccctcttccgtaaaggaagatccaagaaagtttatggcggagaaaga
aatcttgaagcaatgaaaaatttcctcgaaaatgcatcacttccacctataattgaaagt
actaaagaagagatagaagaattaaagaaaaaagaaaattcttttgttattattaagagt
gaagctgatgaccaaattagaaataaattagttgaattagttgatgaattagattatctt
catttctatgcccttaacactgaaatggataattttgaattagctgtatacaatggcgat
tctaaagaaatgtttacttatgaaattactacattggataaatttaatggtattgaattt
attgattgggctaacactaaaacattcccattattccatcaagtcaatatgccattgttt
agaagaattgaaaatcttccagtttatactttatggtatttctatcaaggaacaattcca
aaagttcatgaagatttgtttagaggtttagcaaagaaatataatggaaaattcatattc
ttttcatttaataaaataatttctgaagaccaagttaaacatatgcaccatactggtaat
gtttatccagtaatttctattattcatacaaacaagagaaatatgtatgttatggatgaa
gatgttacaattgatgaagaaacaatcaataattatatcgaaagtattcttaatggaact
gcccaactatactatcaatcatctgatcctattaaaccagaagatcaaaaagatgttttt
aaattaactggtcataatttcaatgaatttgtaacaactaaaggtaaagatagtcttgta
atcttctgtgttgaaagagctgatatgtgtaagtatttcttaacaacaccacttgctaaa
gttgcaaagagaatgcaaggaattgatactttccaaatggcatggattgatgcatctact
gatgacatttcacctgaatggaatttgaatattatcccaaaggtttacttagtcagtgaa
aaagatggagaaacaaagaaggttgaaatgaatgaaatgccaagtgaagaaaatactatg
aaattcattatggaaaatgctttattcaaatttgaaatgcctgcccctttaccagaggaa
aacaaggaagatgagagtccagaaagtgattctgatagcgaagaagcagaaaagaaagaa
gacgtaatagaaaaaccacaagaaaagaaagagctataa

DBGET integrated database retrieval system