KEGG   Entamoeba dispar: EDI_013060Help
Entry
EDI_013060        CDS       T01083                                 

Definition
phosphatidylinositol 3-kinase (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
edi  Entamoeba dispar
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Amoebiasis
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:edi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:edi04070]
Human Diseases; Infectious diseases; Amoebiasis [PATH:edi05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 1124 aa AA seqDB search
MIELKRSQYVIPSPYRRTTWQGLPLAQLPKRIETKPLSSGITPSPLSLLKKEDVDEVNEK
KEPRPSNVNVTITQETVFVAVKDRTGKYYGYAMNVNDIGTSIIETCKSNVYIKGDYALVL
PNLSYRVFDEDSRKPLKDLKFVQGCQYHGIVPYFFLVERKAVIQYASVESVGEYLLQSTL
KYEIIGNNFVGLCRNIGDEFYKFRRALATVCGKEEENKKDLDIYLSEENEYVYCGNEPPI
QDLTKKLIMKGYLFEQKMDKTISHLPTDTVENVISALFTKFTTTNQAAFAATEKAEDFVL
KVRGLHEFLIPKKKDGSLYQLCEFDYIRRCVMKHEKIDLYLAPRKMLHQFIGPLNPIDVN
FTGVYNSLLSHDLWEKVETEKAGQSQKSIERNYFITLKKLSNCVYYKPLPQKKNKENKDD
IPVQEYQNIVSFRAYVTAALFLGPRQLGKMVVTPVFQVNNSMATLDNVMEFDLPIKILPK
ETKLVIGVFQTEEQIGVNIEHLEKKEKNKENPIGTINCKVVDHNGMLLMGNVQCGLWELS
APNFISMCSENIGERAIYLTFTYPTYDVPVLMDAFNDDNIKSDNQEKEKLTAEETKKFKV
ALESNPLQKLTEDEMKLIWKLRYTVKKTKPKNLSRVVAAVDLTDVHAVAELHRLISDWPL
LEPQTAIEMLDFKFPDQRVRDFALKCLDAMDDAELIMFLPQLIQALKFELHHNSELAMFL
LRRALRNKNRIGHQFFWFLKAELHDNRVTERYGLLLEAFVGACGKYQIELYNEVKFQLDL
IDIANHVKTLATKDEQKQYMFESLAKLKYPDNQALPIDSRMRFTRPVPNSGNVFSSKKKP
LLLILQNYDPAGDDIRVIEKVGDDLRQDILTLQILRIMYTMLKNAELDIRMLPYQCIATG
NETGMLELVKDSETYGKIIADDGRRLAVTKNDVLTLWMQKQCARPESKVTFEQAVENFVH
SCAGYCVATYLLGIGDRHSDNVMVTRSGVFFHIDFGHFLGNFKSKFGVKRERTPFKFTQH
YADLMGYKDGVESKDFKEFKELCSSALLSLRKQGSLFIYLFRLMLATGIPELKNEDDIEY
MKNAFMFDEDDQQVKKNFDNMIYQCLDAWSQTLNDLIHDIVHYK
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgatagaactaaaacgaagccagtatgtcattccatcaccttatagaagaacaacatgg
caaggactacctcttgcccaactacctaaaagaattgaaacaaaaccattatctagtgga
ataacaccatcaccattatctttattaaaaaaagaagatgttgatgaagtgaatgaaaaa
aaagaaccaagaccatcaaatgttaatgttactattacacaagaaacagtatttgtagct
gtaaaagatagaacaggaaaatattatggatatgctatgaatgttaatgatattggaact
tctataattgagacatgtaaaagtaatgtttatattaaaggagattatgcattagtatta
cctaatttaagttatagggtgtttgatgaagactctcgtaaaccacttaaagacttaaaa
tttgtacaaggatgtcaatatcatggtatagttccatactttttccttgtagaaagaaag
gcagttattcaatacgcatcagtagaatcagttggagaatatttattacaatcaacatta
aaatatgaaattattggtaataactttgttggattatgtagaaatattggagatgaattt
tataaatttagaagagctttagcaactgtttgtggtaaagaagaagaaaataaaaaggat
ttagatatatatttatcagaagaaaatgaatatgtttattgtggtaatgaacctcctatt
caagatcttacaaaaaaattaattatgaaagggtatttatttgaacaaaaaatggataaa
acaatttctcatttacctactgatactgttgaaaatgttatttctgctttatttactaaa
ttcactactactaatcaagctgcatttgctgctacagaaaaagctgaagattttgtttta
aaagtaagaggattacatgaatttttaattccaaagaaaaaagatggttcgttatatcaa
ttatgtgaatttgattatatcagaagatgtgttatgaaacatgaaaagattgatttatat
cttgcaccaagaaaaatgttacatcaatttattggaccattaaatcctattgacgttaac
tttactggggtttataattcattattatctcatgacttatgggaaaaagtagaaacagaa
aaagctggacaaagtcaaaaaagtattgaacgtaattatttcattacattaaagaaatta
agtaattgtgtttattataaaccattacctcaaaagaaaaataaagaaaataaagatgat
attcctgtacaagaatatcaaaatattgttagttttagagcttatgttactgctgcatta
ttccttggaccaagacaattaggaaaaatggttgttacaccagtatttcaagttaataat
agtatggctacattagataatgtaatggaatttgatttaccaataaaaattcttccaaaa
gaaactaaacttgttattggagtatttcaaactgaagaacagattggagttaatatcgaa
catcttgaaaagaaagaaaaaaataaagaaaatcctattggaactattaactgtaaagtc
gttgatcacaatgggatgttacttatgggaaatgttcaatgtggattatgggaattatca
gctccaaatttcatttctatgtgttcagaaaatattggagaacgagctatttatcttact
tttacatatccaacatatgatgtacctgtattaatggatgcatttaatgatgataatatt
aaaagtgataatcaagaaaaagagaaattaactgctgaagaaacaaagaaatttaaagtt
gcattagaatcaaatccattacaaaaattaacagaagacgaaatgaaattaatttggaaa
ttaagatatacagtcaagaaaactaaaccaaaaaatctttcaagagttgttgctgcagtt
gatttaactgatgtacatgcagttgcagaattacatagattaatatctgattggccatta
ttagaaccacaaacagctattgaaatgttagactttaaattcccagaccaaagagtaaga
gattttgctttaaaatgtctggatgcgatggatgatgcagaattaattatgttccttcca
caattaattcaagcacttaaatttgaattacatcataatagtgaattggcaatgttctta
ttaagaagagcattaagaaataaaaatagaattggacatcaattcttttggttcttaaaa
gcagaattacatgataatagagttactgaaagatatggattattattagaagcatttgta
ggtgcatgtggtaaatatcaaatagaattatataatgaagttaaattccaattagatctt
atcgatattgctaatcacgttaaaacacttgcaactaaagatgaacaaaaacaatatatg
tttgagtcattagctaaattaaaatatcctgacaatcaagcattaccaattgattctaga
atgagatttacaagaccagtaccaaatagtggaaatgtatttagtagtaagaaaaagcca
ttactattaatacttcaaaattatgatccagcaggtgatgacattagagtaattgaaaaa
gttggagatgatttaagacaagatattttaacattacaaatattacgtattatgtatact
atgcttaaaaatgctgaattagatattagaatgttaccatatcaatgtattgccactggt
aatgaaactggtatgttagaacttgttaaagattcagaaacatatggtaaaattattgca
gatgatggaagaagattagcagttactaagaatgatgtgttaacattgtggatgcaaaaa
caatgtgctagaccagaaagtaaagttacttttgaacaagcagtagaaaattttgttcat
tcatgtgcaggatattgtgttgctacatatttacttggtattggagatagacatagtgat
aatgttatggtaacaagaagtggtgtattcttccatattgattttggacatttccttggt
aatttcaagtcaaaattcggagtaaagagagaaagaacaccatttaaatttacacaacat
tatgctgatttaatgggatataaagatggtgttgaaagtaaagattttaaagagtttaaa
gaattatgttcatctgcattactgtcattaagaaaacaaggatcattatttatttatttg
tttagattaatgcttgctactggtattccagaattaaaaaatgaagatgatattgaatat
atgaaaaatgcattcatgtttgatgaagatgatcaacaagttaagaaaaactttgacaat
atgatttatcaatgtcttgatgcatggtctcaaacattaaatgatttgatccatgatatt
gtccattacaaataa

DBGET integrated database retrieval system