KEGG   Entamoeba dispar: EDI_023410Help
Entry
EDI_023410        CDS       T01083                                 

Definition
ubiquitin specific protease (EC:3.1.2.15 1.3.1.74)
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
edi  Entamoeba dispar
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 1295 aa AA seqDB search
MGNTISLRIVNEPQSINYKQILEKCLKNFPTSSIDNVHLANTLFSRIPKPFTQRIFSIFP
EKISFETVVALVYIFMVSPRHTRACFIVDLYIGNKNQLTRDQVYRFFYDLTTETHSNIDI
TILLEDFVSQNKHKDYTDTDLIDYLTFHINIEKVKNLPIFKWIINGSKMPKKGYPLIEPE
RTVNDLLLMWDVTKPKISTLKHSKVTSKIISTYATIDSLCNFKERSIKELREIYYLLHPL
KYTSKGIQIQTVISVFALSLNRSILVPLTTLIKNEKYNEFFIAITFTTKVSKNEKFQFIR
EILNPPKEGIVNKQFVTPIVESISLFYSVVYNSVGEFNLQNKIIEFIWEELKSLGEQFTY
DTFEDTFSSNSNLYTLVDQLTQATTVLHGVLPKKLETEAQVFNALMSMYELNKMKPGEIV
VLIPSSWFSKWTMMLNSSKREPLERINFNLLLDDKVAVTLKPTITERDIIPLHPEVFLVI
NSWYKHEGNVIERRLYYNQEKKRIDIELFPLKLYSFIHIRGELEIPSNTSHIEILLISRF
ASLRELHKLLCTKYKLPINKTRVLMFGKSNIPLVVSIDDGIEIYQYFKEESWVCLETLSV
YSEIQNVNDGLTCIGTRGGEYGIFNEGNTSYISTVIQCLSHTPLIRDFFLSQSFKEDTTN
GPLKNLANAFSNLLYNLWKPSNKPVIVSIKEFREVFINLTQQFNDKDQHDAMEYLTYLLG
CLHESVNRNSGCGLPYLEIPNESLKIIAQNAWKEFNTLNQSIVTDSFTVMTKNKVQCTSC
NHIRYLMNPSNIVLVPLPSEKFKVINFTVVPMNGQIPIKYSIKSTQERLLGDCLKELSLL
CGLSLSHMLCADAPGSIILNILKDSTPIKNLTNGVKVFEVEKFPSIFPERKCLNSVITKS
VKRQSTTNKMAYAPRQSMEVALRNSIKNTVIIPQTSLTPLRMKTEISKKGVVMINCLHRI
VTENEVYFFNKYLTSVVSLPFILTYSYEELTVSNILRGILMHVRVALRQLVVQENKIFVD
LPTTFNIEYLLSKGLEQLPFDLRVTSYDGKNCFDCPWDKDCCGCVLTDKILQQYDFNGFT
FTVCIDWKSDSLIKYDQSIADLYLKDESFTDLRKLQTEPIQLVDCFKLLNLPDEFSIDDG
WVCPHCQAICSATSVISLYSMPVYLIVNLKRFTQNGDKWIKSNIEVTFPIEGLKAKDIVD
SSIETTEEDVYDLYAVINHIGKLNESHYTAICKVDKDKWLKFDDKSVSQVSSDSICTNTA
YILFYQKRNANPEDVMNKYHFTDQKELLRQPCVIM
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatactattagcctcagaatagttaatgaaccacaatcaataaactataaacaa
attcttgagaaatgtcttaaaaattttcctacttcaagtattgataatgttcatcttgca
aataccttatttagtcgaattcctaaaccatttactcaaagaatatttagtattttccct
gaaaaaatttcatttgaaactgttgttgctttagtgtatatatttatggtttcacctcgt
catacccgtgcatgttttattgttgatttatatataggaaataaaaatcaattaacaaga
gatcaagtttatcgttttttttatgatttaacaaccgaaacacactcaaatatagacatt
acaattttacttgaagattttgtttcacaaaataaacacaaagactacactgatacagat
cttattgattatctaacgtttcacatcaatattgaaaaagttaaaaatcttcctatattt
aaatggattattaatggtagtaaaatgcctaaaaaaggatatcctttaattgaaccagaa
agaacagttaatgaccttttgctaatgtgggatgtaacaaaaccaaaaatttctacttta
aaacattctaaggtaacaagtaaaattatttctacatacgcaactattgatagtttatgt
aattttaaagaaaggtcaattaaagaattgagagaaatttactacttattacatccatta
aaatatacatctaaaggaattcaaattcaaacagtcatatcagtatttgctcttagttta
aatcgttcaattttagttccattaacaacattaataaagaatgagaaatataatgagttc
tttattgctattactttcactacaaaagtttcaaaaaatgaaaaatttcaatttattaga
gaaatattgaatccaccaaaagaaggcattgttaataaacaattcgttactccaattgtt
gagtctatttcacttttttattctgttgtttataactcagtaggtgaatttaatttacaa
aataaaattattgaatttatttgggaagaattaaaaagtctaggagaacaatttacatat
gacacatttgaagatacattttcttctaatagtaatttatatactttggttgatcaactg
acacaagccactacagtacttcatggtgttttaccaaaaaaactagaaacagaggcacaa
gtctttaatgctctaatgagtatgtatgaactaaacaaaatgaaaccaggtgaaatcgtt
gttctaattccatcaagctggttttcaaaatggactatgatgcttaattcaagtaaaaga
gaacctttagaacgaattaattttaatttactgttagatgataaagttgcagtaactctt
aaaccaactattacagaaagggatattattcctctacacccagaggtattcttagtgatt
aattcatggtataaacatgaaggaaatgtaattgaaagaaggttatattataatcaagaa
aagaaaagaatagacatagaattatttccgttaaaattatattcatttattcatataaga
ggagaattagaaataccttcaaatacttcacacattgagatattattaatttccagattt
gcttcattaagagagttacataaattattatgtactaaatataaattaccaattaataaa
acacgagtattaatgtttggaaaatcaaatatccccttagttgtatcaattgatgatggt
atagaaatttatcaatattttaaagaagagtcatgggtttgtcttgaaacacttagtgta
tattcagaaattcagaatgtaaatgatggactaacttgcattggtacccgtgggggtgag
tatggtatttttaatgaagggaatacatcttatattagtactgttattcaatgtctttca
cacactcctttaattcgagacttctttttatctcaatcctttaaagaagatacgacaaat
ggaccattgaaaaaccttgcaaatgcattctcaaatttgctatataatttatggaaacca
tctaacaaaccagtaattgtatcaatcaaagagtttagagaagttttcatcaatttaact
caacaatttaatgacaaagaccaacatgatgctatggaatatttaacgtatttattaggt
tgtcttcatgagtcagtaaataggaattcaggatgtggattaccctatttagaaattcca
aatgaaagtctgaagattattgctcaaaatgcatggaaagaattcaatacattaaatcaa
tcaatagtcacagactcatttactgttatgactaagaataaagttcaatgtacgtcttgc
aatcatataagatatctaatgaatccatccaatattgtacttgttccattaccatctgaa
aagtttaaggttattaattttactgttgtacctatgaatggtcaaattccaattaagtat
tcaattaaaagtacccaagaacgattattaggtgattgtcttaaagaattaagtttattg
tgtggtttatccctttcacatatgttatgcgctgatgctccagggtcaataattctcaac
attttaaaagactcaactccaataaaaaatttaacgaatggagttaaagtttttgaagta
gaaaaattcccttccatatttcctgaaagaaaatgcttaaattcagttataactaagtca
gttaaaagacaatcaactacaaacaaaatggcttatgcaccaagacaatcaatggaagtt
gcattaagaaattcaataaaaaatacagtgattatccctcaaacttcattaacaccatta
agaatgaagactgaaatatcaaagaaaggagttgttatgattaattgtttacataggatt
gttactgaaaacgaagtatatttctttaataaatatttaacttcagttgtttccttacca
tttattcttacttactcatatgaagaacttacagtatcgaatattttacgtggaatatta
atgcacgttagagttgctcttagacaacttgttgtccaagaaaataaaatatttgttgat
ttaccaacaacatttaatattgaatatttattatcaaaaggattagaacaattaccattt
gatttaagagtaacaagttatgatggaaagaattgttttgattgtccatgggataaagac
tgttgtgggtgtgtattaacagataaaattcttcagcaatatgacttcaatgggtttaca
tttactgtttgtattgactggaaaagtgattcattaattaaatatgaccagtcaattgct
gacttatatcttaaagatgaaagttttacagacttaagaaaattacaaacagaacctatt
caattagttgattgttttaaattacttaatttacctgatgaattttcgattgatgatggt
tgggtatgtccacattgtcaggctatttgttctgcaaccagtgttatttcattatactct
atgccagtatatttgatagttaacttaaaaaggttcactcaaaatggtgataagtggatt
aaaagtaatatcgaagttactttccctattgaaggattaaaagcaaaggacatagttgat
agttcaatagaaactactgaagaagatgtttatgatttgtatgcagtaattaaccatatt
ggaaaattaaatgagagtcattacactgcaatttgtaaagttgacaaagacaaatggcta
aaatttgatgataagtctgtatctcaagtttcttctgatagcatctgtaccaacactgcc
tatattcttttctatcaaaaacgaaatgccaatccagaagacgtcatgaataagtatcat
tttactgatcaaaaagagttattaagacagccttgcgttattatgtaa

DBGET integrated database retrieval system