KEGG   Entamoeba dispar: EDI_025400Help
Entry
EDI_025400        CDS       T01083                                 

Definition
1-O-acylceramide synthase precursor (EC:2.3.1.43)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
edi  Entamoeba dispar
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:edi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 439 aa AA seqDB search
MNILFLCLLLSITIAETCTRHPVIIIPGIMASMLNAKINIPKSVDFCDRKLDCDRSKDWF
TLWLNLLDGIPYVNDCYIAYLTCHYNSTSGRMENVEGVQIEPPRFGSTYAVDTISPSFPL
KTFSRAFHEIIKGLEKIGYKDEFDLFSAPYDWRYYHHDEYYEKVKELIIKAYENTGNKVV
LVSHSMGGLTTYILLDKLGKEFCDKYIHRWVAMSTPFIGTTIANDIVLSGYNMGYPVSKE
LIKKASRTFETVAMMGPIGEYWDQNEVLVELANGKKYYPKDQVELFSQLEEMKPFAKEAV
ENSFAPYLKKYNSQVPHGVEMHCGITSGIETAHKITFKGDTFDSKSTIEFVDGDQEVTLN
SLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNSLEYCKKMTENFTNLGKYTH
QGMLLKKEVIEYVKNLACD
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaacatactctttctttgcttgcttttatctattactattgctgaaacttgtactcgt
catccagtcattattattcctggaattatggcttcaatgctcaatgctaaaataaatatc
cctaagagtgttgacttttgtgatagaaaacttgattgcgatagatctaaagattggttc
actttatggttaaatttgttagatggaattccatatgtcaatgattgttacattgcttat
ttaacatgtcattataattctacttcaggtagaatggagaatgttgaaggagtacaaata
gaacctccaagatttggatccacttatgctgtagatactatttctccatcatttccatta
aagacattttctcgtgcattccatgaaattataaaaggattagaaaaaattggatataaa
gacgaatttgatttgttctctgcaccttatgattggaggtattatcaccatgatgaatat
tatgaaaaagttaaggaattaataattaaagcttatgaaaatacaggtaataaagtagtt
ttagtttcacattctatgggaggactaactacttatattttattagataaacttggcaaa
gaattttgtgataagtatattcatagatgggttgctatgtctactccattcattgggaca
actatcgctaatgacattgttctttctggatataatatgggatatcctgtttctaaagag
ttaattaaaaaagcatcaagaacatttgaaacagtagctatgatgggacctattggggag
tattgggaccaaaatgaagttttagtagaattagctaatggtaaaaaatattatccaaaa
gatcaagttgagttatttagtcaattagaagaaatgaaaccttttgctaaagaagcagta
gaaaattcatttgcaccatatcttaagaaatataattcacaagtaccacatggagtagaa
atgcattgtggtattacaagtggaatagaaactgcacataaaataacttttaagggagat
acttttgactctaaatcaactatcgaatttgtagatggtgatcaagaagttactttgaat
agtttagaannnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnttactttgaat
agtttagaatattgtaaaaagatgacagaaaactttactaatttaggtaaatatactcat
caaggaatgttgttaaagaaagaagtaattgagtatgttaaaaatcttgcttgtgactaa

DBGET integrated database retrieval system