KEGG   Entamoeba dispar: EDI_026840Help
Entry
EDI_026840        CDS       T01083                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
edi  Entamoeba dispar
Pathway
edi00040  Pentose and glucuronate interconversions
edi00052  Galactose metabolism
edi00500  Starch and sucrose metabolism
edi00520  Amino sugar and nucleotide sugar metabolism
edi01100  Metabolic pathways
edi01130  Biosynthesis of antibiotics
Module
edi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EDI_026840
   00052 Galactose metabolism
    EDI_026840
   00500 Starch and sucrose metabolism
    EDI_026840
   00520 Amino sugar and nucleotide sugar metabolism
    EDI_026840
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EDI_026840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP YcgL
Motif
Other DBs
NCBI-GeneID: 5885342
NCBI-ProteinID: XP_001740185
UniProt: B0EPY3
AA seq 474 aa AA seqDB search
MNTQEIRLKTEEIIQHLLQQGASEDDTKNLKSFQILHNAYLEQIDKKTTGIEWEKVESLP
KEFSVDYCTLDKDFTKEEIIALLKKICIIKINGGLGTSMGCTGPKSVIEVRNGLTFLDII
ILQLKALSREYGVVVPLVLMNSFSTNVETEKVIKKYEQDNDVRILTFLQHKFPRIDAQTL
LPVCTELNGRKEEWYPPGHGDFLQSFVDSKAFQILKEEGKEYLFLSNSDNLGAIPDISIM
HHFAKNHFDFALELTPKTLNDVKGGTLIRYGDKLKMLEIAQVPTEHVAEFKDIKKFKVFN
TNNIWMNMSAIQHVVEKRTLLNNMDIIVNRKKDGQRDVIQLEIAVGCAVSAFEHTTAYIV
PRSRFLPVKACNDLFIIQSTLFGLNESGHMVDNARKVTDIPPSVTFSKDFQFISDYQKHM
QQIPNIEHLNALVVDGNIIFGKNVKLVGDVLLKNTTTKPIVLEDRTIENTAMIF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaagagatcagattaaagactgaagaaattatccaacaccttcttcaacaa
ggagccagtgaagatgacactaagaatttaaagtcatttcaaattctccataatgcttat
cttgaacaaatagataaaaagactactggtattgaatgggaaaaagttgaatcacttcca
aaagagttttctgtagattattgtacattagataaagattttacaaaagaagagattata
gcacttttaaagaaaatttgtattattaagatcaatggaggattaggaacttctatggga
tgtactggtccaaaaagtgtaattgaagttagaaatggattgacattcttagatattata
atacttcaattaaaagcattatctcgtgaatatggggttgttgttccattagttcttatg
aactctttttctactaatgttgaaacagagaaagttattaaaaaatatgaacaagataat
gacgtaagaatactaactttcttacaacataaatttcctagaattgatgcacaaactctt
cttcctgtatgtactgaattaaatggaagaaaagaagaatggtatccaccaggacatgga
gattttttacaatcatttgttgactctaaggcattccaaatattaaaagaagaaggaaaa
gaatacttattcttatcaaattcagataatcttggtgctattcctgatattagtattatg
catcattttgctaaaaatcattttgattttgccttagaattaactccaaaaactttaaat
gatgttaaaggaggtactcttattagatatggtgataaattaaaaatgttagaaattgca
caagttccaactgaacatgttgcagaatttaaagatattaagaagtttaaagtatttaac
actaataatatttggatgaatatgtctgctatccaacatgttgttgaaaaaaggacatta
ttaaataatatggatattattgttaatcgtaaaaaagacggacaaagagatgtcattcaa
ttagaaattgcagttgggtgtgcagtaagtgcatttgaacatactactgcatatattgtt
ccaagatcaagattccttccagtaaaagcatgtaatgatttatttattattcaaagtaca
ttatttggattaaatgagtcaggccacatggttgacaatgctcgaaaggtaacagatatt
ccaccatcagttacatttagtaaagatttccaatttattagtgattaccaaaaacatatg
caacaaattcctaatattgaacacctcaacgcacttgttgttgatggaaatattattttt
ggaaaaaatgttaagttagtaggtgatgtattattaaaaaatacaacaactaaacctatt
gtattagaagataggactatagaaaatactgcaatgatattctaa

DBGET integrated database retrieval system