KEGG   Entamoeba dispar: EDI_035230Help
Entry
EDI_035230        CDS       T01083                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
edi  Entamoeba dispar
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:edi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:edi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:edi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:edi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:edi00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 261 aa AA seqDB search
MSARKFVVGGNWKCNGTLASIETLTKGVAASVDAELAKKVEVIVGVPFIYIPKVQQILAG
EANGANILVSAENAWTKSGAYTGEVHVGMLVDCQVPYVILGHSERRQIFHESNEQVAEKV
KVAIDAGLKVIACIGETEAQRIANQTEEVVAAQLKAINNAISKEAWKNIILAYEPVWAIG
TGKTATPDQAQEVHQYIRKWMTENISKEVAEATRIQYGGSVNPANCNELAKKADIDGFLV
GGASLDAAKFKTIINSVSEKF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctcgtaagtttgtcgttggtggaaattggaaatgtaatggtactcttgctagt
attgaaacattaactaaaggagttgctgcctcagttgatgctgaacttgccaagaaagtt
gaagttattgttggagttccatttatctatattccaaaagtccaacaaattcttgcagga
gaagctaatggtgctaatattcttgtttctgctgaaaatgcatggactaaatctggagct
tatactggagaagttcatgtaggaatgttagttgattgtcaagtcccatatgtcattctt
ggacattctgaaagaagacaaattttccatgaaagtaatgaacaagtcgctgaaaaagtt
aaagttgctattgatgctggattaaaagttattgcttgtattggtgaaactgaagcacaa
agaattgctaatcaaactgaagaagttgttgcagcacaactcaaagccattaacaatgct
atttcaaaagaagcatggaaaaacattattcttgcttatgaaccagtctgggctattgga
actggaaagactgctactccagatcaagctcaagaagttcatcaatacattagaaaatgg
atgactgaaaatatttctaaagaagttgctgaagctacaagaatccaatatggtggatct
gttaatccagctaattgtaatgaacttgctaagaaagctgacattgatggtttcttagtt
ggaggagcctcattagatgccgctaaattcaagactatcattaactcagtttctgagaaa
ttctaa

DBGET integrated database retrieval system