KEGG   Entamoeba dispar: EDI_035230Help
Entry
EDI_035230        CDS       T01083                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
edi  Entamoeba dispar
Pathway
edi00010  Glycolysis / Gluconeogenesis
edi00051  Fructose and mannose metabolism
edi00562  Inositol phosphate metabolism
edi01100  Metabolic pathways
edi01110  Biosynthesis of secondary metabolites
edi01130  Biosynthesis of antibiotics
edi01200  Carbon metabolism
edi01230  Biosynthesis of amino acids
Module
edi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
edi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EDI_035230
   00051 Fructose and mannose metabolism
    EDI_035230
   00562 Inositol phosphate metabolism
    EDI_035230
Enzymes [BR:edi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EDI_035230
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EDI_035230
  Exosomal proteins of bladder cancer cells
   EDI_035230
  Exosomal proteins of melanoma cells
   EDI_035230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM DUF3212
Motif
Other DBs
NCBI-GeneID: 5884699
NCBI-ProteinID: XP_001739563
UniProt: B0EN40
AA seq 261 aa AA seqDB search
MSARKFVVGGNWKCNGTLASIETLTKGVAASVDAELAKKVEVIVGVPFIYIPKVQQILAG
EANGANILVSAENAWTKSGAYTGEVHVGMLVDCQVPYVILGHSERRQIFHESNEQVAEKV
KVAIDAGLKVIACIGETEAQRIANQTEEVVAAQLKAINNAISKEAWKNIILAYEPVWAIG
TGKTATPDQAQEVHQYIRKWMTENISKEVAEATRIQYGGSVNPANCNELAKKADIDGFLV
GGASLDAAKFKTIINSVSEKF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctcgtaagtttgtcgttggtggaaattggaaatgtaatggtactcttgctagt
attgaaacattaactaaaggagttgctgcctcagttgatgctgaacttgccaagaaagtt
gaagttattgttggagttccatttatctatattccaaaagtccaacaaattcttgcagga
gaagctaatggtgctaatattcttgtttctgctgaaaatgcatggactaaatctggagct
tatactggagaagttcatgtaggaatgttagttgattgtcaagtcccatatgtcattctt
ggacattctgaaagaagacaaattttccatgaaagtaatgaacaagtcgctgaaaaagtt
aaagttgctattgatgctggattaaaagttattgcttgtattggtgaaactgaagcacaa
agaattgctaatcaaactgaagaagttgttgcagcacaactcaaagccattaacaatgct
atttcaaaagaagcatggaaaaacattattcttgcttatgaaccagtctgggctattgga
actggaaagactgctactccagatcaagctcaagaagttcatcaatacattagaaaatgg
atgactgaaaatatttctaaagaagttgctgaagctacaagaatccaatatggtggatct
gttaatccagctaattgtaatgaacttgctaagaaagctgacattgatggtttcttagtt
ggaggagcctcattagatgccgctaaattcaagactatcattaactcagtttctgagaaa
ttctaa

DBGET integrated database retrieval system