KEGG   Entamoeba dispar: EDI_036660Help
Entry
EDI_036660        CDS       T01083                                 

Definition
serine/threonine protein kinase ppk15 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     EDI_036660
Protein kinases [BR:edi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   EDI_036660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 679 aa AA seqDB search
MSTTTHHHRKRFIKSDFRMNYLCSQDSFFTPFSKENRSMSPGIDFESSVRQATISYIDVL
KRCNPKFDFSSIITKRALTSPSTPAHNDYHDNCKYDYILYTDEVIGTGVPGVVSYGKKQG
TRYRVLCLLGQGAFGQVVKCFDEVNKTFVAIKVLKNRPAYYRQAMLEIAVLQVLNEKFDV
DGTGHTLRLLDHFVFHNHVCIVTELLSINLYELMKQNGCRALFVQLARSILKQLLESLVI
LFRNGIIHCDLKPENVLLVDITKKIKLIDFGSACFENSTLYSYIQSRHYRSPEVILGLPY
SSAIDMWSFGCMAAELFVGIPIFPGNSEYNMLYKFINMLGMPPRSLLDKGSKTTKFFRRK
RPAEMKNKDDVWAFKSKREFEEDNNIYTEPNREYFSYKTLEDIAMKVTFRVNAPEEPHKM
EMRIAFLDFLKRSLQWDPEVRMRPDQALQHPFITKNPLPSNYTLPPTTEPLRSFPPGTQL
TTEEVLQKIAPNPAAAQKLRTMGYNATTYYQVYADGLSKGIVLNILNSNPFFLQPMTPPA
LIRINQQEEEKKRRLLEENKGNILYQGIGSSTIQQEVMKNRSLFKEHSKKEEHKKQRRQT
SDVFSNKGMETLSPRTEDFLVAQSMKIDQQQATSYAGTNITLPGSTSDGSMAGSWSTQTG
MLLPGGTTMGTTGSMNPYD
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaacaacccaccatcatagaaagagatttatcaaatctgattttcgtatgaat
tacctttgttcacaagacagtttctttacaccatttagtaaagaaaatcgttcgatgtca
ccagggattgattttgaatcttcagtacgacaagcgactattagttatattgatgtatta
aaaaggtgtaatccaaaattcgatttttcttctattattacaaagagagcattaacatca
ccatcaacaccagcacataacgattatcatgataattgtaaatatgattatattctttat
acagacgaagttattggaactggagttccaggagtagtttcatatggaaaaaaacaagga
acaagatatagagttctttgcttattagggcaaggagcatttggacaagttgtaaaatgt
ttcgatgaagtaaataaaacatttgtagcaattaaagtattgaaaaatagaccagcttat
tatagacaagctatgttagaaatagcagtgttacaagtattaaatgaaaaatttgatgtt
gatggaacaggacatacacttcgtcttttagatcattttgtatttcataatcatgtttgt
attgtaacagaattattatcaattaacttatatgaattaatgaaacaaaatggttgtcgt
gcattatttgttcaattagcacgatcaattctcaaacaattattagaatcacttgttata
ttatttagaaatggaattattcattgtgatcttaagccagaaaatgtattattagttgat
ataacaaagaaaattaaattaattgattttggttcagcgtgttttgaaaatagtacatta
tattcttatattcaatcaagacattataggtcaccagaagttatattagggttaccttat
tctagtgcaattgatatgtggtcatttggatgtatggcagcagaattatttgttgggata
ccaatatttccaggaaatagtgaatataatatgttatataaatttattaatatgttagga
atgccaccaagaagtttattagataaaggaagtaaaactactaaattttttagaagaaaa
agaccagcagaaatgaaaaataaagacgatgtttgggcatttaaaagtaaaagagaattt
gaagaagataataatatttatactgagccaaatagagaatatttttcatataaaacatta
gaagatattgctatgaaagtcacttttagagttaatgctcctgaagaacctcataaaatg
gaaatgagaattgcatttttagatttccttaaacgatcacttcaatgggatcctgaagtt
agaatgagacctgatcaagctttacaacatccttttattactaaaaatccattaccaagt
aattacactcttccacctactacagaaccattaagatcattcccaccaggaactcaactt
actacagaagaagtattacaaaaaattgcaccaaatccagctgcagcacaaaagttaaga
actatgggatataatgctacaacttattatcaagtttatgctgatggattaagtaaagga
attgtattaaatattcttaattctaatccattctttttacaaccaatgacaccacctgca
ttaattcgtataaaccaacaagaagaagaaaagaaaagaagattattagaagaaaataaa
ggaaatattttgtatcaaggaattggttcatctacaattcaacaagaagttatgaagaat
agatctttgtttaaagaacattctaaaaaagaagaacataagaaacaaagaagacaaact
agtgacgtcttctcaaataaaggaatggaaactttatctcctcgtactgaagacttttta
gtggctcaaagtatgaaaattgatcaacaacaagctacttcatatgctggtactaatatt
acattaccaggttcaacatctgatggatcaatggcaggttcttggagtacacaaacaggc
atgttgcttccaggaggaactacaatgggaactaccggaagtatgaatccatatgattaa

DBGET integrated database retrieval system