KEGG   Entamoeba dispar: EDI_063170Help
Entry
EDI_063170        CDS       T01083                                 

Definition
sphingosine kinase (EC:2.7.1.138)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
edi  Entamoeba dispar
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:edi00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 426 aa AA seqDB search
MRESEEYIEIGKERIAKKDICLYKYEEGEFVGHLLEAKGKTKKHRVIKVKMEKEEYKKLK
IEIDKKKKYPKLYIILNPFSGTKKGEIIMKEIEEYLISMGIIYTIQKTEYPGHEKEIAEK
TDFSQYDVIVSGGGDGTLYSIINGIISQHKKEIPIVSPLACGSGNGVAYSLYKDNEPITG
MCHIICGEVTRIDGIILNHHKKKKKYYGILQFEFSYLSSIDFESECIRWLGAFRFILWTL
WYCVTLMTTKAKIKTKKYEMTNDGECGALCSTCKNNKIKELDYTKDIADQIIQQHIDPDS
SLSKNDGWEELPYSSYCIYFFNNFAYGMPGIEFAHGAHRNDGFIDSWILPGERATRWRFL
GFWICAVLNLFVPNYISGFDYFRSTALSIRLQNDVVIGIDGEKLPPGNSFDLYVAPGLYR
TMLCTN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatcagaagaatacatcgaaataggaaaagagagaattgcaaaaaaagatatt
tgtctttacaaatatgaagaaggagagtttgtaggacatcttcttgaagctaaaggaaaa
actaaaaagcatcgagttattaaagtgaaaatggaaaaagaagaatataaaaaattgaaa
atagaaatagataaaaagaaaaaatatccaaaattatatattatattaaatccatttagt
ggaacaaaaaaaggagaaataataatgaaagaaatagaagaatatttaataagtatggga
ataatatatacaattcaaaaaacagaatatccaggacatgaaaaagaaatagcagaaaaa
actgattttagtcaatatgatgttattgtatcgggaggaggagatggaacattatattca
ataattaatggaattatttcacaacataaaaaagaaattccaatagtatcaccacttgca
tgtggatcaggaaatggagtagcatatagtttatataaagataatgaaccaataacagga
atgtgtcatataatatgtggagaagttacaagaattgatggaattatattaaatcatcat
aaaaaaaaaaagaaatattatggaatattacaatttgaattttcatatttatcaagtatt
gattttgaaagtgaatgtattagatggcttggagcatttagatttattttatggacactt
tggtattgtgttacacttatgactactaaagcaaaaataaaaactaaaaaatatgaaatg
acaaatgatggagaatgtggagcattatgttctacttgtaaaaataataaaataaaagaa
ctagattatacaaaagatattgctgatcaaattattcaacaacatatagatcctgattct
tctctctctaaaaatgatggttgggaagaattaccttattcttcttattgtatttatttt
tttaataatttcgcttatggaatgccaggaattgaatttgctcatggtgctcatagaaat
gatggttttattgattcatggattcttcctggtgaaagagcaactcgttggagattttta
ggtttttggatttgtgctgtattaaatctttttgtacctaattatatttcaggttttgat
tattttagatcaactgctttatctattagattacaaaatgatgtcgtaattggtatcgat
ggtgaaaaacttcctccaggaaatagttttgatttatatgttgcccctggtttatatcgt
actatgttatgtactaattaa

DBGET integrated database retrieval system