KEGG   Entamoeba dispar: EDI_067880Help
Entry
EDI_067880        CDS       T01083                                 

Definition
protein disulfide isomerase (EC:5.3.4.1 1.8.1.8)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
edi  Entamoeba dispar
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EDI_067880
Enzymes [BR:edi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EDI_067880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 337 aa AA seqDB search
MKFILFTLLTFLVSADVVSLNPANFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLADA
YKNKQDIVIAELDCDNKDHKDLCGKFGINGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFI
EEKIQPKAPSNVVSVTSATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGE
DDLVIAEVDCTENQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYG
YDRDETGKLGKMAGRIAELDDLVKGFVDKENKEEIIKKAEAIEGGAYYVKVMKRIIERGA
DYVEKEKARINKILENPSMKAKKIDDFTRNLNVLEVF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcattctttttactttacttacttttttagtatctgctgatgtggtatcatta
aacccagcaaattttaatacaattgttgatggaagtaaacatgtctttgttaagttcttt
gctccatggtgtggacactgcaaaaaacttgccccagaatatattaaacttgctgatgct
tacaaaaataaacaagacatcgtaattgctgaacttgattgtgacaataaggaccacaaa
gatctttgtggaaagtttggaattaatggatttccaactttaaaattcttcagaaaagga
actactgaaccaattgagtatgagggtggaagaactgttgaagacctttctcattttatt
gaagaaaagattcaacccaaagcaccttctaatgttgtctcagtaacaagtgctacattt
gatagcattgtaatggacccaactaaaaatgtctttgttaaattctttgctccatggtgt
ggacattgcaaagctcttgcaccaaaatatattgaagttagcaagatgtatgctggtgaa
gatgaccttgttattgctgaagttgattgtactgaaaatcaagagacatgtaacaaatat
gaagtccacggatatcctactttaaaatcattcccaaagggagaaaataagaaacctatt
gcctatgaaggaggaagagaagttaaggactttgttacatatttcaatacaaattatgga
tatgatagagatgaaactggaaagttaggtaaaatggcaggaagaattgctgaacttgat
gaccttgttaaaggatttgttgataaagagaacaaagaagaaattattaagaaggctgaa
gcaatagaaggaggagcttattatgttaaagttatgaaaagaattattgagagaggagca
gattatgtagaaaaagaaaaggctagaatcaacaaaatcttagaaaatccatctatgaaa
gccaagaaaattgatgacttcactagaaacttgaatgtacttgaagttttctaa

DBGET integrated database retrieval system