KEGG   Entamoeba dispar: EDI_083840Help
Entry
EDI_083840        CDS       T01083                                 

Definition
histone acetyltransferase type B catalytic subunit (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EDI_083840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 392 aa AA seqDB search
MEDPNLMDKDPLANKNKDFICSAQDAIGLYFVSNKEEVEKTLKDKYLENAVDYPDYVHQL
FMGDCEIYGYKDLKVHVLISVYSHQMYVDFSYSQKIDDAEDVVKCLHKFMPKNQRILSLE
GFIEQLEKEKYGFKPCGKKLYEFEQNGEVYEIYYGDVNNMYEYYCQLFPVITMYIERANC
VNPEGKWEFFNLFQVIENPSNISQTEYRIAAQTNTYRFYHYPDSWRLRIGQFITFPNYQR
KKLGRYLLKQVYSFILSDKDFDLTVEDACLEFQKLRTFVELKMMEEQQLKLPIDIHSDTL
SECPEDFCEIVRKKCGITKMEIMSLYEMMVWAELKNNNEVMPKLALELKRKYYSQTKTEL
ELLENDEMRLEMIERAYKAKIAHFKQIYNILE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcctaatttaatggacaaagatccacttgcaaataaaaacaaagattttata
tgttcagcacaagatgcaataggattgtattttgtttctaataaagaagaagtagaaaaa
acactcaaagacaaatatttagagaatgcagttgattatcctgattatgttcaccaatta
tttatgggagattgtgaaatatatggatataaagatttaaaagttcacgttttgattagt
gtctattcacatcaaatgtatgttgatttttcatattcacaaaagatcgatgatgcagaa
gatgtagtaaaatgtcttcataaatttatgccaaaaaaccaaagaattttatcattagaa
ggttttattgaacaattagaaaaagaaaagtatgggtttaaaccttgtggaaagaagtta
tatgaatttgaacaaaatggagaagtttatgaaatttattatggagatgttaataatatg
tatgagtattattgtcaattatttcctgttattacaatgtatattgaacgagcgaattgt
gttaatccagaaggaaaatgggaattttttaatttgtttcaagtcattgaaaatccatca
aatataagtcaaactgaatataggatagctgcacaaacgaatacatatagattttatcat
tacccagattcatggagattacgtattggacaatttataacatttcctaattaccaaaga
aaaaaattaggaagatatttattaaaacaagtatattcatttattttatctgataaagat
tttgatttaactgttgaagatgcatgtttagagtttcaaaaattaagaacatttgtagaa
cttaaaatgatggaagaacaacaattaaaattacctattgatattcattcagatacatta
agtgaatgtccagaagatttttgtgagatagttagaaaaaaatgtggaataacaaaaatg
gaaataatgtcattatatgaaatgatggtatgggcagaattaaaaaataataatgaagta
atgcctaagttagcattagagttaaaaagaaagtattattcacaaactaaaacagaactt
gaattactagaaaatgatgaaatgagattagaaatgattgaaagagcatataaagcaaaa
attgctcattttaaacaaatttacaatattttagaataa

DBGET integrated database retrieval system