KEGG   Entamoeba dispar: EDI_097190Help
Entry
EDI_097190        CDS       T01083                                 

Definition
beta-hexosaminidase beta chain precursor (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
edi  Entamoeba dispar
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EDI_097190
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    EDI_097190
   00603 Glycosphingolipid biosynthesis - globo series
    EDI_097190
   00604 Glycosphingolipid biosynthesis - ganglio series
    EDI_097190
   00511 Other glycan degradation
    EDI_097190
Enzymes [BR:edi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EDI_097190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 513 aa AA seqDB search
MSLSTQCQTNPNCLSFMKFNFNHTITFPLQQQKNLRDFRISLHKAIDIPHIIPLSPKFIK
QVNIIFKSSDEKIYYPSTIIGSDESYSLSISTSSIIIEAQTVYGARHALETLLQLIRPNK
NTFVISQLPITITDSPRFKWRGLMVDLARNAISKLTLVKTINALASLKMNVLHLHLTDSQ
SFMFESSSFPELSKQGAFNQENVLNKPFIIQLVRYAALRGILVYPEIDIPGHTASWNLGY
PGVTVDCWDYLTSNKVLYAENRVSLNPTNETSFHIVRTILKELAETFGNQYIHIGGDEVD
NNCWLNSKEYPVIKEWMKKNNFDSISDVESYYNQIAQEEVIKQGAHPIVWEEVFKKGNAK
KDSTIIQVWSDIRQLKLAVDSGYKAIYSAGLYLDRQVPLCNGFDPSSCEQRYMWVWTTRD
FYKHDPTKDFTDAELENVYGGEGCSWDESCDDENFFDRVFQRFSAVAERFWSNKNLIDDE
SHEVRANYLRCLGKRRGFLKGTGPLYTSYCDAK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcttatcaactcaatgccaaactaaccccaattgtttaagttttatgaaatttaat
tttaatcacacaataacttttcctttacaacaacaaaaaaatctaagagactttagaatt
tcattacataaggcaattgatattcctcatattattcctttaagtcctaaattcattaaa
caagttaatattatttttaagtcttcagatgaaaaaatatattatccatcaactattatc
ggatcagatgaatcttattctctttctatttctacttcttctattattattgaagctcaa
actgtttatggagcaagacatgcattagaaacattactccaattaattcgaccaaataaa
aatacatttgttatttctcaattaccaataacgatcactgattctccaagattcaaatgg
agagggttaatggttgatcttgctagaaatgctattagtaaattaactcttgtaaaaact
attaacgcattagcttcattaaaaatgaatgttctccatcttcatttaactgattctcaa
tcatttatgtttgagtcatcttcatttccagaattatctaaacaaggtgcatttaatcaa
gaaaatgtattaaataagccatttattattcaattagtacgttatgcggctttaagaggt
attcttgtttatcctgaaattgatattccagggcatactgcatcatggaatcttggttat
ccaggagttactgttgattgttgggattatctaacatcaaataaagtgttgtatgctgaa
aatagagtatcactaaatccaaccaatgaaacatcttttcatatagtacgaacaatatta
aaagaattagcagaaacatttggaaatcaatatatccatattggaggggatgaggttgat
aataactgttggttaaattcaaaagaatatcctgttattaaagaatggatgaaaaagaat
aactttgattcaatttctgatgtagaaagttattataatcaaattgcccaagaagaagtt
ataaaacaaggtgcccatcctattgtttgggaagaagtttttaagaaaggaaatgctaaa
aaagactcaacaatcattcaagtatggagtgatattagacaattaaaattagcagttgat
tctggatataaagcaatttattcagctgggttatacctagatagacaagtacctttatgt
aatggatttgatccatcttcttgtgaacaacgatatatgtgggtctggacaacaagagac
ttttacaaacatgatccaactaaagattttactgatgctgaattagaaaatgtttatggt
ggagagggatgttcttgggatgaaagttgtgatgatgaaaatttctttgatagagttttc
caaagattttcagctgttgcagaaagattttggagtaataagaatcttattgatgatgaa
agtcatgaagttagagcaaattatcttcgttgtttaggaaagagaagaggatttttaaaa
ggaacaggacccttatacacttcatattgtgacgctaaataa

DBGET integrated database retrieval system