KEGG   Entamoeba dispar: EDI_113230Help
Entry
EDI_113230        CDS       T01083                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EDI_113230
Transfer RNA biogenesis [BR:edi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    EDI_113230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 576 aa AA seqDB search
MKSNVIRGRKGPAKYGRNSVQFVACINEIVQVMIDLYEKGEEINLNKLKSQMAQKHNLHT
APKQVDIIAAIPDSHRPFLLPIVKSKPVRTASGIVAIAVMCKPHRCPNIRTNGDSCVYCP
GGCDSDFEYSTQSYTGYEPTSMRAVRARYNPYIQSRSRVEQLQKLGHSVEKVEYIIMGGT
FLSMDKHYRDSFILGLFDALSGHVSSTVEEAVHYGENSKVKCVALTIETRPDCCSEDHIR
EMFRYGTTRLEIGLQSIFEDICKECNRGHTVRDCIGCYKRLKDAGYKIVTHMMPNLPGVP
PERDVFTYSEMFSDGAYQCDGLKLYPCLVIRGTRLYEMWRKGHYHSYTSEETIDVLSRIL
ALIPPWVRVHRIQRDIPIPLVSAGADKGNLREYVQRQMDANNWPCRDTRTREVGIAALQG
KPGKKIKCVKDIELIRRDYVGSDGWETFLSYEDPENDLLIGLLRLRLPTDEKFMPELKGK
TSIIRELHVYGTSIPVNTKNLNQFQHMGYGALLIQEAERIAREEHGSDKIVIISGVGVRH
YYRKFGYTLDGPYMAKSLNEDHPQLQDIRRFNDYEN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaacgttattagagggcgtaaaggtcctgctaagtatggaagaaattctgtt
caatttgttgcatgcattaatgaaattgttcaagtgatgattgacttatatgaaaaaggt
gaagaaattaatttaaataaattaaagtctcaaatggctcaaaaacataatttacataca
gcacctaaacaagttgatattatcgccgctattcctgattctcatcgtccatttcttctt
cctattgttaaatcaaaaccagttcgtactgcttcaggtattgttgctattgctgtaatg
tgtaaaccacatcgttgtccaaacattagaactaacggtgattcatgtgtttattgtccc
ggtggttgtgattctgattttgaatattctacacaatcttatactggttatgaaccaact
tctatgcgtgctgttcgtgcaagatataatccatatattcagtcaagatcaagagtagag
caacttcaaaaacttggtcatagtgttgaaaaagttgagtatattattatgggaggtaca
ttcctttctatggataaacattatagagactcttttattcttgggttatttgatgcatta
tcaggacatgtctcatctactgttgaagaggcagtacattatggagaaaattctaaagta
aaatgtgttgctttaactattgaaacacggcctgattgttgttcagaggatcatataaga
gaaatgtttagatatggaacaactcgtttagaaattggattacaatcaatttttgaagat
atttgtaaagaatgtaatagaggacatactgttcgagattgtattggatgttataagaga
ttaaaagatgcaggatataagattgttactcatatgatgccaaatcttccaggtgtacca
cctgaaagagatgtttttacatatagtgaaatgtttagtgatggggcatatcaatgtgat
ggattaaagttatatccatgtcttgttattcgtggaactcgtttatatgaaatgtggaga
aaaggacattatcattcatatacatctgaagaaactattgatgtcctttcacgtattctt
gcattaattccaccttgggtaagagtgcatcgtattcaaagagatattccaattccatta
gtttctgctggtgctgataaaggtaatttaagagaatacgttcaacgtcaaatggatgct
aataattggccatgtagagatactagaactagagaagttggtattgctgctctacaaggt
aaaccaggaaagaaaattaaatgtgtaaaagatattgaattgataagaagagattatgtt
ggttctgatggatgggaaacattcttatcatatgaagacccagaaaatgatttattaatt
ggattgttaagacttagacttccaactgatgaaaagtttatgccagaacttaaaggaaaa
acatcaatcataagagaattacatgtttatggtacttctattccagttaatactaagaat
ttaaatcagttccaacatatgggttatggtgctttacttattcaagaagctgaaagaatt
gctagagaagagcatggaagtgataaaattgttattatttctggtgttggagtacggcac
tattatagaaaatttggttatactttagatggtccatacatggccaaatcattaaatgaa
gatcatccacaattacaagatatcagaagatttaatgattatgaaaattaa

DBGET integrated database retrieval system