KEGG   Entamoeba dispar: EDI_118370Help
Entry
EDI_118370        CDS       T01083                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
edi  Entamoeba dispar
Brite
Exosome [BR:edi04147]
 Exosomal proteins
  Proteins found in most exosomes
   EDI_118370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 130 aa AA seqDB search
MSWQSYVDSFLVGAGKGMGGAIIGLQGGVWAASANCTPSAQESVTIGTACASNIAGLQQS
GVVIGGKKFMITRVDADEGSAMGKKGAEGISIYKTKQAVIIGYFSDASVSAGQNSDATYK
CAKYLMDAGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaatcatatgttgattcattccttgttggagctggaaaaggtatgggtgga
gctattattggacttcaaggtggtgtttgggctgcttcagctaactgcactccatctgct
caagaatcagttactattggaactgcttgtgcttcaaatattgctggacttcaacaaagt
ggagtcgttattggtggcaagaaattcatgatcaccagagttgatgctgatgaaggatct
gctatgggtaagaaaggtgctgaaggtatctcaatctacaagaccaaacaagctgttatc
attggatacttctcagatgcttcagtctctgctggacaaaactctgatgccacttacaag
tgtgctaaatatctcatggacgctggatattaa

DBGET integrated database retrieval system