KEGG   Entamoeba dispar: EDI_121990Help
Entry
EDI_121990        CDS       T01083                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
edi  Entamoeba dispar
Brite
Enzymes [BR:edi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     EDI_121990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 252 aa AA seqDB search
MNNENIYYLFLLIMLIIGFIVFILLHYITVGYGMFQNNKWGLTINNKIGWCVMEIVSMIG
IIIFYIYSSMNEIIPMISLILFIIHYFRRSIIFPLRISKGGKMPIIIMLMGMLFNLCNCY
AQAGWLFFYHPPYYYLRWFNTPQCYFGLLFFFIGMVINIHSDEIIRSLRKEGETEHKLPQ
GGLFNYVTSAQYFGELVEWLGFSIFTLSPGAILFFFWTFANLTPRARSIHLAYRKKFKNQ
VGKRKILIPFIY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaaaatatatattatttatttcttcttataatgttgataattggatttatt
gtatttattttacttcattatattactgttggatatggaatgtttcaaaataataaatgg
ggattaacaataaacaataaaattggatggtgtgttatggaaatagtatcaatgattggt
ataattatcttttatatttattcttctatgaatgaaataattccaatgatttcattaatt
ctttttataattcattattttagaagaagtattatttttccattaagaatatcaaaagga
ggaaaaatgcctattatcataatgttaatgggaatgttatttaatttatgtaattgttat
gcacaagcaggatggttatttttttatcatccaccatattattatttaagatggtttaat
actccacaatgttattttgggttgttattcttctttattggaatggtaattaatattcat
tctgatgaaataataagaagtcttcgtaaagaaggagaaacagaacataaattacctcag
ggtggattatttaattatgttacttcagctcaatattttggtgaattagttgaatggtta
ggtttttctatatttacattatctccaggtgctattttattctttttctggacatttgct
aatcttacaccaagagcaagaagtatccatctagcttatagaaaaaagtttaaaaaccaa
gttgggaaaagaaagattttgattccatttatttattaa

DBGET integrated database retrieval system