KEGG   Entamoeba dispar: EDI_130180Help
Entry
EDI_130180        CDS       T01083                                 

Definition
serine/threonine protein kinase (EC:2.7.11.1)
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
edi  Entamoeba dispar
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 317 aa AA seqDB search
MFSFTSKAAIPSKSQQYIPTKPMAVPRRFAQLPAKSPLKKEIESKPKKVEERKPGQLSLE
MFDVGKPLGQGKFGNVYLVKYKKYDYVCALKVVFKRQLQKCGMGIQMKREIELQSHLNHP
NILKLFGFFEDENRWFLVLEYCKKGELYGLLQKAGRFDEKRAARYIKATTEALKYCQEMN
CIHRDLKPENIMIDHNDQVKLADFGWSVHTNTKRNTYCGTLDYLSPEIVQEKYYDGSIDQ
WCLGVLTFELCTGEPPFQSATRDEVMKKVRNVKYSFPSYLTGDCKDFINKLIQYDPSKRM
TFTECLAHPWITKNTTN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtttcacctctaaggctgctattccatctaagtctcaacaatatattcctacc
aaacctatggctgtcccccgtagatttgcccaattaccagcaaagtcccctcttaaaaag
gaaatcgaaagtaaaccaaaaaaagttgaagaaagaaagccaggtcaactatcactagaa
atgtttgatgttggaaaaccacttggccaaggcaaatttggaaatgtttatcttgtaaaa
tacaaaaaatatgattatgtgtgtgcattaaaagttgtttttaaaagacagttgcaaaaa
tgtgggatggggattcaaatgaaaagagaaattgagttgcaatctcatcttaaccaccct
aatattcttaaattatttgggttttttgaagacgaaaataggtggtttcttgttcttgag
tattgtaagaaaggtgagttatatggattgttacaaaaagctggtcgttttgatgaaaag
agagctgcccgatatataaaagcaacaactgaagccctgaagtattgccaagagatgaac
tgtatccatcgtgatttaaaaccagaaaatattatgatagatcacaacgatcaggttaaa
ttagctgattttgggtggtctgttcatacaaatactaaaagaaatacctattgtggtaca
ttagattatttatctcctgaaattgtacaagaaaaatattatgacggatcaattgaccaa
tggtgtttaggggttttaacatttgaactatgtactggtgaaccaccattccaatctgct
actcgtgatgaagttatgaaaaaggttagaaatgttaagtattcttttccgagttatctt
acgggtgattgcaaagattttattaacaaattaattcagtatgacccttctaaaagaatg
acttttacagagtgtttggctcatccatggataaccaaaaacacaacaaattga

DBGET integrated database retrieval system