KEGG   Entamoeba dispar: EDI_134130Help
Entry
EDI_134130        CDS       T01083                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
edi  Entamoeba dispar
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EDI_134130
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EDI_134130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 302 aa AA seqDB search
MKRVVIVGSSNTDLIGYCERYPQPGETILGKEFHTGFGGKGANQCIMASKFNDVEVSMVG
FLGHDQFGNSTLQNYKDNGVNTSQIHFCNLPTGVAMITVDETAQNQIIVIPGANEALTPQ
FISANANDIFKKGDIVVCQNEIPLEATYEALKQAKQHGCLTLWNPAPAPKEINRNIIKYV
DTLIVNTNESMQIGSENTPEESALKLHKEFGVLVIVTLGDKGCLIVGDEQIKIESVRVNA
IDTTGAGDAFVGSYARCWAIGLDPKRSAEISVRIASDSVTRHGTQSSYPNKERIQKIISE
IN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtggtaattgttggttcttcaaatactgatcttattggatattgtgagcgt
tatccacaacctggagaaactattcttggtaaagaatttcacactgggtttggaggaaaa
ggagcaaatcaatgtattatggcatctaaattcaatgatgttgaagtttctatggttggt
ttcttaggtcatgaccaatttggcaattcaactttacaaaactataaagataatggagtt
aatactagccagatccatttttgtaatttaccaactggtgttgcaatgatcactgttgat
gaaacagcacaaaaccaaatcattgttattccaggagcaaatgaagcacttactcctcaa
tttataagtgctaatgccaatgacatttttaaaaaaggagatatcgttgtttgtcaaaat
gaaattcctctcgaagccacatatgaggcattaaaacaagctaaacaacatggttgtctt
acattatggaatcctgctcctgcaccaaaagaaattaaccgtaatatcataaaatatgtt
gacacactaattgttaatactaatgaatcaatgcaaattggtagtgaaaatacacctgaa
gaatctgcacttaaattacataaagaatttggagttcttgttattgttacattaggagat
aaaggttgtttaattgttggagatgaacaaattaaaattgaatctgtccgtgtcaatgcc
attgacacaacaggggcaggggatgcatttgttggaagttatgcacggtgttgggcaatt
ggacttgatccaaagagatcagcagagatttctgttagaatagcttcagactctgttact
agacatgggactcaatcatcatatccaaataaagaacgaattcagaaaattatttctgaa
ataaattaa

DBGET integrated database retrieval system