KEGG   Entamoeba dispar: EDI_135290Help
Entry
EDI_135290        CDS       T01083                                 

Definition
eukaryotic translation initiation factor 3 subunit
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
edi  Entamoeba dispar
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EDI_135290
Translation factors [BR:edi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    EDI_135290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 215 aa AA seqDB search
MSWEDFDIAEEPDFGETTSTLAALAPETKEETKTVSNKELKEAKKNNVKVVEEYVDPTEG
MTEEEKSLALRRQQEESDIKGAERLYQGVDDLHELDTMSVITDKDFQKYGKLLGLKGHAL
YKEKSKQYKLLVKECMRELTNDLTSVEIKELSAYMEVLFNQQVQIEKEADKKKKKGGKKN
LAKPATTGKKYTERVEDQLEDDYYDDEDEDDYDFM
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggaagattttgatattgcagaagaacctgattttggagagaccacttctaca
ttagcagccttagcaccagaaaccaaagaagaaacaaaaactgttagtaataaggaactg
aaagaagcaaagaaaaataatgtaaaagttgtagaagaatatgttgatccaactgaagga
atgactgaagaagaaaagtcattggctttgagaagacaacaagaagagtcagacattaaa
ggagcagaaaggttgtatcaaggagttgatgacttgcatgaattagacactatgtcagtt
attactgataaagatttccaaaagtatggtaagttattaggattaaagggtcatgctctt
tataaagaaaaatcaaaacaatataaattacttgttaaagaatgtatgagagaattaact
aatgatttaacaagtgttgaaattaaagaattaagtgcttatatggaagtactctttaat
caacaagttcaaattgagaaagaggctgataaaaagaaaaagaaaggaggtaaaaagaat
ttagctaaacctgctacaactggaaagaaatatactgaaagagtagaagatcaacttgaa
gatgattattatgatgatgaagatgaagacgattatgatttcatgtaa

DBGET integrated database retrieval system