KEGG   Entamoeba dispar: EDI_144560Help
Entry
EDI_144560        CDS       T01083                                 

Definition
serine/threonine protein phosphatase PP1 isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
edi  Entamoeba dispar
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:edi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 294 aa AA seqDB search
MDTTHLDDIISRLMNVINSFPENIIVTKDEIMQLCDVFQEEVSKDETLMELKAPINVIGD
LHGQFTDLIRFLKAVNYTEEKFLFLGDFVDRGCHSIEVLCLVYALKARYPQQFFIIRGNH
ECEEINRVFGFYDECIRRYDESVWKRFNATFAYLPILALINKKILCVHGGISPDLKLLSQ
IQTISRPLQIPCGGMVCDLLWSDPGSMFGWKPNTVRGMSHYYGEDVCIEFMERNELELIC
RGHEVVDGYQFKFNQKLVTLFSSPVYCNALNNSGAMMVVADDLTCSFVILKVDK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggacacaacacacttagatgatattatctcaagattaatgaatgttattaattcattc
ccagaaaatatcattgtgacaaaagatgaaattatgcaactttgcgatgtatttcaagaa
gaagtaagtaaagatgaaacattaatggaattaaaagcaccaattaatgtaattggagat
ttacatggacaatttactgatttaattcgatttttaaaagcagtaaattatactgaagaa
aaatttttgtttcttggagattttgttgatagaggatgtcatagtatagaagtactatgt
cttgtttatgcactaaaagcgcgttatccacaacaatttttcattattagaggaaatcat
gaatgtgaagaaattaaccgagtttttggattttatgatgagtgtattcgtagatatgat
gaaagtgtttggaaacgatttaatgctacttttgcttatttaccaattttggcgttaata
aataaaaaaatactatgtgttcatggtggaatctcacctgatttaaaattattaagtcaa
atacaaacaatttctagacctctacaaatcccatgtggaggaatggtttgtgatttatta
tggtctgaccctggttcaatgtttggatggaaaccaaacactgttaggggaatgtctcat
tattatggagaagatgtttgtattgaatttatggaacgaaacgaattggaattaatttgt
cgaggacatgaagtagttgatgggtatcaatttaaatttaatcaaaagttagtcacatta
tttagttctccagtttattgtaatgcattaaataattcaggagcaatgatggttgttgca
gatgatctcacttgttcatttgtaattctaaaagttgataaataa

DBGET integrated database retrieval system