KEGG   Entamoeba dispar: EDI_145960Help
Entry
EDI_145960        CDS       T01083                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
edi  Entamoeba dispar
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EDI_145960
   00052 Galactose metabolism
    EDI_145960
Enzymes [BR:edi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EDI_145960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MTIVAQREDFCSTIKGKEVDLYTLTNEFLTINLTNYGCRLIDIITQGKNGPVNVLIGFRS
LKGIMQCDNCMGAIIGRYANRIYKGDLVIDGHKYQLPINNGINCLHGGDGFDKKVFTVTK
ITKTEVVLELDDKDGSNNFPGNVHVVITYELHENNLVMTFEATTDQTTVVNITNHSYLNL
NGDGSIVHHQLQIYSDQFLPITNEIVPTGEIRKVENTPFDFREFKEIGKEINDEYEQLKL
GTGYDHSFIINENAPHCSWDKNLKQIACVKGDLSEIQMSIYSSQPGVQFYTSNFMPEGFK
TRTAFCLETQHFPDSPHHPEFPSTYLKKGELYHHVCVYQFQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgttgctcaaagagaagatttttgtagtactattaaaggaaaagaagtagat
ttatatactttaacaaatgaatttttaacaattaaccttactaattatggttgtcgtctt
attgatattattactcaaggaaagaatggccctgttaatgttttaataggttttcgtagt
ttaaaaggaattatgcaatgtgataattgtatgggagctatcattggtagatatgctaat
agaatttataaaggagatcttgttattgatggtcataaatatcaattaccaattaataac
ggaattaactgtctccatggaggagatggatttgacaaaaaagtatttacagtaacaaaa
attactaaaacagaagtagtattagaattagatgataaagatggatctaataatttccca
ggaaatgttcatgttgttataacctatgaattacatgaaaataatttagttatgacattt
gaagcaacaactgatcaaactactgttgttaatatcactaaccattcttatttaaattta
aatggagatggatctattgttcatcatcaacttcaaatatatagtgaccaattccttcct
ataacaaatgaaattgtacctactggagaaatacgaaaagttgagaatacaccttttgat
tttagagagtttaaagaaattggtaaagaaataaatgatgaatatgaacaattaaaatta
ggaactggatatgaccactcatttatcataaatgaaaatgctccacattgttcatgggat
aaaaaccttaaacaaatagcatgtgttaagggagatctaagtgaaatccaaatgtcaatt
tattcgtctcaacctggtgttcaattttatacatctaattttatgcctgaaggatttaaa
acaagaacagctttttgtttagaaactcaacactttcctgattcacctcatcatccagaa
tttccttcaacctatttaaaaaaaggagagctttaccatcacgtttgtgtttatcaattc
cagtaa

DBGET integrated database retrieval system