KEGG   Entamoeba dispar: EDI_145990Help
Entry
EDI_145990        CDS       T01083                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
edi  Entamoeba dispar
Brite
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EDI_145990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 847 aa AA seqDB search
MSQPQWVLTQKKTFTKWANVQLSGAYVINDVETDLNDGLILISLFEALRKQKVQFRYNKK
PKMRVAKLENTEQALNFIKADGVKLVNIDAQNIVDGNLTLILGLLWTLILKYQIAQNKMD
ASKNALLEWVNSKLTSRKIKNFSNDWNTGDVLNELIHALEPDFIDLADSASKGEGEERIQ
YGLSIAEDKMEIPAIIAAEDMALPEPDELSVMAYVSYFRHYEAEKEKRLGEAERLAREAE
LMRTPDPSKCVMSGPGLKTGEVLVPQEFTVTAKNCKGDQITQGGVTWNAHVFDPEGNEIP
IEQKDNGDGTYDMTYVPQVPGKHKVEVAYEDKQLKQSPAIVMIEPAKADPENTYADGEGV
EKCDAGKGPVNFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEIPHELVDNNDGTYTGSYV
PVPGIDTVFITLLNQGIKGNPYQCKVFQDPSTACIGESYAFGPGVEGGVTIDKTPVFRIQ
GVTPEGKKCTKGGDEFKVEVTDPEGKKQTAKVVDRHNGKYDVKYKAKVPGIYDVQVLLKN
PENPEEFKDIKGSVYHPEIKDGVDAKKCIVDGEGIERPNDQEDNVFTIHAKNFKGEDVLV
GGHPFQVIIDQVTESEKKKKKEGEKSSSSSSSEEEDDDAEDEELFAFLNDGESGDNEEEK
VNEEEKEKEEKKEEEEPKKEEEKEKEEGVEEPKEEIEGKKVAQKQQGSIPCTVIDNENGT
YDVHYRAAAGKIRVKIELNKQKVGKSPYHLEVEEDADADESGVENFCFVVQAKNRRGQVQ
ADGKAKFTVELDGPNGKLEEQKVKVKHLGEGKYFIRYSLPAEKGEYHINCKLNRRHIAGS
PFKQTVN
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaccacaatgggttcttacccaaaagaaaacatttactaaatgggcaaatgtc
caattaagtggagcatatgttataaatgatgttgagacagatttaaatgatggattaatc
ttaatatcattatttgaagctttaagaaaacaaaaagtacaattcagatataacaagaaa
ccaaagatgagagtagctaaattagaaaatacagaacaagcattaaatttcattaaagct
gacggagttaaattagttaatattgatgctcaaaatattgttgatggaaatttgacactt
attcttggacttctttggacacttattcttaaataccaaattgctcaaaataaaatggat
gcatcaaagaatgcattacttgaatgggttaactctaaattaacatcaagaaaaattaaa
aacttttcaaatgattggaatacaggggatgtattaaatgaattaattcatgctcttgaa
ccagattttattgatttggctgattcagcttcaaaaggagaaggagaagaaagaattcaa
tacggattaagtattgcagaagataaaatggaaattccagctattattgcagcagaagat
atggcacttccagaacctgatgaattatctgttatggcatatgtttcttatttcagacat
tatgaagctgaaaaagaaaagagattaggagaagctgaaagacttgcacgtgaagcagaa
ttaatgagaacaccagatccatcaaaatgtgttatgtcaggacctggacttaaaacagga
gaagttcttgtaccacaagaatttactgttacagctaagaattgtaaaggagatcaaatt
acacaaggaggagttacttggaatgcacatgtttttgatcctgaaggaaatgaaattcca
attgaacaaaaagataatggggatggaacatatgatatgacatatgttccacaagtacca
ggaaaacataaagttgaagttgcatatgaagataaacaattaaaacaatcaccagctatt
gttatgattgaaccagctaaagcagatccagaaaatacatatgcagatggagaaggtgta
gagaaatgtgatgcaggaaaaggaccagttaactttactattcattgtgtaaataaagtt
ggaacagctgtgccagttactggagctaaatttaaagtcatcattagatctaatgatggt
aatgaaattccacatgaacttgttgataataatgatggtacttatacaggaagttatgtt
ccagttccaggaattgatactgttttcattacattattgaatcaaggtattaaaggaaat
ccatatcaatgtaaagtcttccaagatccatctactgcatgtattggagaatcatatgca
tttggaccaggagttgaaggaggagttactattgataaaacaccagttttcagaattcaa
ggagtcacaccagaaggaaagaaatgtactaaaggaggagatgaatttaaagttgaagtt
acagatccagaaggaaagaaacaaacagcaaaggttgttgatagacataatggtaaatat
gatgttaaatataaagctaaagttccaggtatttatgatgttcaagttcttttgaaaaac
ccagagaatccagaagaatttaaagacattaaaggatcagtttatcatccagaaattaaa
gatggagttgatgctaaaaaatgtattgttgatggagaaggtattgaacgaccaaatgat
caagaagataatgtctttactattcatgctaagaactttaaaggagaagatgttttagtt
ggaggacatccattccaagttatcattgatcaagtcacagaaagtgaaaagaagaagaaa
aaagaaggagaaaaatcaagtagttcttcctcttcagaagaagaagatgacgatgcagaa
gatgaagaattgtttgcattcttgaatgatggagaatctggagacaacgaagaagaaaaa
gtaaatgaggaagaaaaggaaaaagaagaaaagaaggaggaagaagaaccaaagaaagaa
gaagaaaaggaaaaagaagaaggagttgaagaaccaaaagaagaaattgaaggaaagaag
gtagcacaaaaacaacaaggaagtattccatgtactgttattgataatgaaaatggtacg
tatgatgttcattatagagctgctgcaggtaagattagagttaagatagaattaaataaa
caaaaagtaggtaaatcaccatatcatcttgaagttgaagaagacgctgatgcagatgaa
tcaggagttgaaaacttctgttttgttgtccaagctaagaatagaagaggacaagtccaa
gctgatggaaaagctaaattcacagttgaacttgatggaccaaatggtaagcttgaagaa
caaaaagttaaagttaaacatcttggagaaggaaaatatttcattagatattctcttcca
gcagaaaaaggagaatatcatattaattgtaagttgaacagaagacatattgctggatca
ccatttaaacaaacggtcaattaa

DBGET integrated database retrieval system