KEGG   Entamoeba dispar: EDI_146160Help
Entry
EDI_146160        CDS       T01083                                 

Definition
(RefSeq) beta-hexosaminidase beta chain precursor
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
edi  Entamoeba dispar
Pathway
edi00511  Other glycan degradation
edi00520  Amino sugar and nucleotide sugar metabolism
edi00531  Glycosaminoglycan degradation
edi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EDI_146160
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    EDI_146160
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    EDI_146160
   00604 Glycosphingolipid biosynthesis - ganglio series
    EDI_146160
   00511 Other glycan degradation
    EDI_146160
Enzymes [BR:edi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EDI_146160
Chaperones and folding catalysts [BR:edi03110]
 Intramolecular chaperones
  Others
   EDI_146160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 5886620
NCBI-ProteinID: XP_001741649
UniProt: B0EU90
AA seq 565 aa AA seqDB search
MIVLLLFVSYCIAGNGVNVKNQLLLMPYPTTVNAQFGRNDCVEATSNIKMVLSNNCQSDP
NCLSFMTFNFNHTITYPLQRQRNLDDFRVSIFAPIDIEEMKGDIVYSANTVNIELTGNSI
EEIYPTLKIGNDESYSLDITKEGIKISATTVYGARLGLETLIQLLRPYQGKYIIKHIPIM
IEDKPRLQWRGLMIDTARNSFSRSTFVKIINAMAAIKANVLHIHLSDAQTFMFESKEYPE
LSKKGAFFQNKVLTQAFIKQLVQYGAKRGIIVYPEIDTPAHTASWNAGYPGVVADIWDYI
VSSSMRYGENVLALNPANEKTFSIIDALMKEMGEVFGNEYVHFGGDEVWTGAWSKAKEYP
AIIEWMNNKGINTLKELEAYFNKYAQEQIIKNGKTPVCWEEVYQKGSADKKTIIQVWNNV
NLLKEAATAGYKVILSAGYYLDMQMPLCSDYVENSCTNPNHMWVWTNRDMYRNDPIKDLD
YATKQNVLGGEACSWDENADEQNFFDRVFQRFSAVAERFWSSEDITDPESHEVRANYVRC
LGLRRNFLKGTGPLYHSYCQLPEDI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcttttactttttgtttcatattgcattgctggtaatggtgttaatgtaaaa
aatcaattacttttaatgccatatccaacaaccgtcaatgcacaatttggaagaaatgat
tgtgttgaagcaacatcaaatattaaaatggtattatcaaataattgtcaaagtgaccct
aactgtttatcatttatgacattcaattttaatcatacaattacttatccattacaaaga
caaagaaatcttgatgattttagagtttcaatttttgcaccaattgatatagaagaaatg
aaaggagatattgtatattcagcaaatacagttaatattgaattaacaggaaatagtatt
gaagaaatttatccaacacttaaaattggaaatgatgaaagttattcattagatattaca
aaagaaggaattaaaattagtgcaacaacagtttatggagcaagattaggattagaaaca
ttaattcaattattaagaccatatcaagggaaatatattattaaacatataccaattatg
atagaagataaaccaagattacaatggagaggattaatgattgatacagctagaaattca
ttttctagaagtacatttgtaaaaattattaatgcaatggcagcaattaaagcaaatgta
ttacatattcatttaagtgatgcacaaacatttatgtttgaatcaaaagaatatccagaa
ttaagtaaaaaaggagcatttttccaaaataaagtattaacacaagcatttattaaacaa
ttagtacaatatggagctaaaagaggaattatagtatatccagaaattgatacaccagca
catacagcatcatggaatgcaggatatccaggagtagttgcagatatttgggattatatt
gttagtagttcaatgagatatggagaaaatgtattagcattaaatccagcaaatgaaaaa
acatttagtataattgatgcattaatgaaagaaatgggagaagtatttggaaatgaatat
gttcattttggaggagatgaagtttggacaggagcatggtcaaaagcaaaagaatatcca
gcaataatagaatggatgaataataaaggaattaatacattaaaagaattagaagcatat
tttaataaatatgcacaagaacaaattattaaaaatggtaaaacaccagtttgttgggaa
gaagtttatcaaaaaggaagtgcagataaaaaaactattattcaagtatggaataatgtt
aatttattaaaagaagcagcaacagcaggttataaagttattttatcagcaggatattat
ttagatatgcaaatgccattatgtagtgattatgtagaaaatagttgtactaatccaaat
catatgtgggtatggacaaatagagatatgtatagaaatgatccaattaaagacttagat
tatgctactaaacaaaatgtattaggaggagaagcatgttcatgggatgaaaatgctgat
gaacaaaatttctttgatagagttttccaacgattctctgctgttgcagaaagattttgg
agttcagaagatattactgatcctgaaagtcatgaagtccgtgcaaattatgtaagatgt
cttggtttaagaagaaacttcttaaaaggaactggtccactttatcattcatattgtcaa
cttcctgaagacatctaa

DBGET integrated database retrieval system