KEGG   Entamoeba dispar: EDI_155460Help
Entry
EDI_155460        CDS       T01083                                 

Definition
calcineurin subunit B (EC:1.6.3.1)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
edi  Entamoeba dispar
Brite
Protein phosphatases and associated proteins [BR:edi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     EDI_155460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 179 aa AA seqDB search
MGNTLSGLKQEDVEQMMATTNFTESELRRLFRRFKKLGMKAKEGASEEYDDLAELTSNPV
LQRLLEIFNRYENEEVQFSQFVATLSTLSDKGSQEAKLRFAFQVYDVDNDGFISNPELFK
VLKMIIGSSFTDEQLQQVVDKTIIEADKDRDGKISYEEFCSIILKNSENIGEKLTINWQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataccctctctggattaaaacaagaagacgttgaacaaatgatggccacaacc
aacttcactgaaagcgaattaagacgtttattccgtcgttttaaaaaattgggaatgaaa
gctaaagaaggtgcttctgaagagtacgatgaccttgctgaattaacttctaacccagtt
cttcaaagacttcttgaaatcttcaatcgttatgaaaatgaagaggtacaattttctcaa
tttgttgcaaccctttcaaccctttctgataaaggaagtcaagaagcaaaacttagattt
gctttccaggtgtatgatgttgataatgatggttttatatcaaatccagagttatttaaa
gttcttaaaatgatcattggtagctcttttactgatgaacaattacaacaagtagttgat
aaaactattatcgaagctgacaaagatagagatggaaagatttcatatgaagaattctgc
agtattatcttaaagaactctgaaaatattggagaaaaacttacaattaattggcaataa

DBGET integrated database retrieval system