KEGG   Entamoeba dispar: EDI_165200Help
Entry
EDI_165200        CDS       T01083                                 

Definition
inositol monophosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
edi  Entamoeba dispar
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EDI_165200
Enzymes [BR:edi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     EDI_165200
Transfer RNA biogenesis [BR:edi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    EDI_165200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 285 aa AA seqDB search
MQTSLFEFASVLITAVKEASCGISKFKEEVEIKYKSDGSEVTQVDTQSQQIIFSIIKNKY
PTINIIGEEDIGSGTPNNQLPIITQLSFDSLENKIININDIVIYVDPLDGTDCYTHKQYD
SVCVLVGVTYKGKPMLGIVSKPFYNNEITFAIENYVSSISLQPLNDKIIFVCSKKNDIQH
LINSFPDPYEVKYKGGSGAKMMAIIHQEADIYYHPLIQSCTWDTLAAQVILEAQGGMVCD
IYGNPLCYPTSKKESMRHKKGVLCLSPRAKKYLPYMLSISKTISL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacttcactatttgaatttgctagtgtccttattacagctgtaaaagaagcgagt
tgtggcatcagtaaatttaaagaagaagttgaaataaaatataaatctgatggatcagaa
gtaacacaagttgatactcagtcacaacaaatcatattttctataattaaaaataaatat
cccacaattaatattattggggaagaagatattggaagtggaactcctaataaccaattg
ccaataattacacaactatcgtttgattcattagaaaataaaataattaatattaatgat
attgttatttatgttgatccccttgatggaacagattgttatacacataaacaatatgat
agtgtttgtgttttggttggagtaacgtataaaggaaaaccaatgttaggaatagtttcc
aaaccattttataataatgaaataacatttgcaattgagaattatgtttcatctatttca
cttcaaccattaaatgacaaaatcatttttgtatgtagtaaaaaaaatgatattcaacac
ttaattaattcatttcctgatccttatgaagttaaatataaaggtggttctggtgctaaa
atgatggctattattcaccaagaagcagatatttattatcatccattaattcaatcatgt
acttgggatacacttgctgcacaagtaattcttgaggcacaaggaggaatggtttgtgac
atttatggaaatccactttgttatccaacttcaaaaaaagaatctatgagacacaaaaaa
ggagtgttatgtttaagtccaagagcaaaaaaatatttaccttatatgttatctatttca
aaaacaatttcactttaa

DBGET integrated database retrieval system