KEGG   Entamoeba dispar: EDI_165680Help
Entry
EDI_165680        CDS       T01083                                 

Definition
eukaryotic translation initiation factor 4E (EC:3.4.21.59)
Orthology
K03259  
translation initiation factor 4E
Organism
edi  Entamoeba dispar
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:edi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 200 aa AA seqDB search
MSVRVLEPHQLTMTLNAEPIDGQHKLNSSWTLWYDQPSNESIPYGSNTKEVYCFGTVENF
WRMYNNIIKASDLVCMSSYYLFRKGIEPKWEDEQNKNGGRWIHYCGKTMKNEGIEEKWLN
TILACIGEDFPSSELVKGCVFNCKKNQIRISLWVGEHDDSKAVKLIGSKFKSILDLDQEK
IVFHIHQDSVDGRFFNVISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgagagtattagaaccacatcaattgactatgacattaaatgctgagcctatt
gatggtcaacataaattaaattcttcatggacattatggtatgaccaaccttcaaatgaa
agtatcccttatggatcaaacacaaaagaggtttattgttttggtactgtcgaaaacttt
tggagaatgtataacaatattattaaagcctctgatttagtttgtatgagtagttattat
ctctttagaaaaggtattgaaccaaaatgggaagatgaacaaaacaaaaatggaggtaga
tggattcattattgtggcaaaactatgaagaatgaaggaattgaggaaaagtggttaaac
actattttagcatgtattggagaagacttcccttcaagtgagttagtcaaaggatgtgtt
tttaattgtaaaaaaaatcaaataaggatttctttatgggtaggagagcatgatgactcc
aaggctgtgaaattgattggaagtaagtttaaatcaattcttgaccttgaccaggaaaaa
atagtcttccatattcaccaagactctgttgatggacgtttcttcaatgttatcagttta
taa

DBGET integrated database retrieval system