KEGG   Entamoeba dispar: EDI_171020Help
Entry
EDI_171020        CDS       T01083                                 

Definition
1,4-alpha-glucan-branching enzyme (EC:3.1.21.4 2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
edi  Entamoeba dispar
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EDI_171020
Enzymes [BR:edi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EDI_171020
Exosome [BR:edi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EDI_171020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 680 aa AA seqDB search
MSTKLQMIVDDPYLEPFAATIYGRQKKTLDVLSKIEHNEGSLEEFANSYKRYGLNRTTQK
ENGKEVEGWSIREWAPNFKEMYLFGDFNKWDRATAIKLVRDEFGTHSGFIPDENGESRIK
HLSKIKVFGITYSGERLDRIPTYHRYCVLNPKTSSMEAVVYNPEHPYIPTSPKPKIPKAL
KIYESHVGICTPEKKIASYDEFRERIVPYCKKVGYNTIQLMAIMEHPYYASFGYQVTNFF
AASSRFGTPDALKHLIDECHKEGIIVLLDIVHSHTSANVVDGINMFDGSDGHYLLAGEQG
KHPLWGSRLFNYNNYETLRFLLSNVKYYAEEFGFDGFRFDGVTSMIYTHHGVGAHTFDYA
HYFSPNANEDALTYLSLVNILVHRKNMNCVTVAEDVSGYAGLCRTFEDGGIGFDYRLAMS
CPDLWVEYLKTKKDEEWNVNHIGFVLNNRRWKEKAIAYAECHDQALVGDKTISFWLMDKE
MYTGMSCLWQPSLIIDRGIALHKMIRLVTCMLGGEGYLTFMGNEFGHPEWLDFPREGNGD
SFHYCRRQYNLVEDHLLRYKFLLAFEREMLHLEDQYPWLNKPNAYISKHNEGDHVLAFQR
GAVIGIFNFHYEKSFTGYGIGVKEPGTYKIILNSDSSEFGGYDRITSQEYISQPIECDGL
PNQIQIYIPCRVAIVLTKIN
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaattacagatgattgtagatgatccatatcttgagccatttgctgcaaca
atttatggaagacaaaagaaaacacttgatgttctttcaaaaatagaacataatgaagga
tcgttagaagaatttgctaattcatataaacgatatgggttaaatagaacaacacaaaaa
gaaaatggaaaagaagtagaaggatggagtattagagagtgggcacctaattttaaagaa
atgtatttatttggagattttaataaatgggatagagctacagctattaaattagttcgt
gatgaatttggaacacatagtgggtttattccagatgaaaatggagaatctagaattaaa
catttaagtaaaataaaagtatttggtataacgtattcaggagaacgattagatagaatt
cctacatatcatagatattgtgttcttaatcctaaaacatcatcaatggaagctgttgtt
tataatccagaacatccatatattccaacatcaccaaaaccaaaaatcccaaaagcatta
aaaatatatgaaagtcatgttggaatttgtacaccagaaaagaaaatagcaagttatgat
gaatttagagaaagaattgttccatattgtaaaaaagttggatataacactattcaatta
atggctattatggaacatccatattatgcatcttttggatatcaagtaactaatttcttt
gctgcatcatcaagatttggaacacctgatgcattaaaacatttaattgatgaatgtcat
aaagaaggaattattgtattattagatattgttcattcacatacttctgcaaatgtagtt
gatggaattaatatgtttgatggaagtgatggacattatttacttgcaggagaacaagga
aaacatccattatggggatcaagattatttaattacaacaattatgaaacattaagattt
ttattatctaatgttaaatattatgcagaagaatttggatttgatggatttagatttgat
ggagtaacttctatgatttatactcatcatggtgttggagcacatacttttgattatgca
cattattttagtccaaatgcaaatgaagatgcattaacttatttatcattagttaatatt
cttgttcatagaaaaaatatgaattgtgttactgtagcagaagatgtatcaggatatgca
ggattatgtagaacatttgaggatggaggaattggatttgattacagacttgctatgtca
tgtccagatctttgggtagaatatttaaaaacaaagaaagatgaagaatggaatgtaaat
catattggatttgtattaaataatagaagatggaaagaaaaagctattgcttatgcagaa
tgtcatgaccaagcattagttggtgataaaactatctcattttggttaatggacaaagaa
atgtatactggaatgtcatgtttatggcaaccatcattaattattgatagaggaattgct
ttacataaaatgattcgattagtaacttgtatgttaggaggagaaggatatttaacattt
atgggaaatgaatttggacatccagaatggcttgatttcccaagagaaggaaatggtgat
tcattccattattgtagaagacaatataatttggttgaagaccatttattaagatataaa
tttttattggcttttgaaagagaaatgcttcatttagaagatcaatatccatggttaaat
aaaccaaatgcttatatctcaaaacataatgaaggagatcatgttttagcattccaaaga
ggagcagttattggaatttttaatttccattatgaaaagagttttacaggatatggaatt
ggagtaaaagaaccaggaacatataaaatcatattaaactcagactcttcagagtttgga
ggatatgatagaattacttctcaagaatacatctctcaaccaattgaatgtgatggatta
ccaaatcaaattcaaatttatattccttgcagagttgctattgttttaacaaaaataaat
taa

DBGET integrated database retrieval system