KEGG   Entamoeba dispar: EDI_196330Help
Entry
EDI_196330        CDS       T01083                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
edi  Entamoeba dispar
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:edi00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 898 aa AA seqDB search
MVFITIHYSTPFGQAVCLEVSGEKKLYKLNYVDNNTWSGEVAFASTGLINYRYLITKEDD
LTEIFRTEGSKESYPHFLDLTNLKSFGKVEVNDIFISGFDAEDTFLTTSYFRKVIYGKRQ
EEKLSIKKLGQTTLLLKVRCTCVPEGQCVFVGGAIESLGKWDVSKAIKMTPTHVPYYEAL
IDISNETASFEYKCFIADANSRTNARWEDRSNRVYYIAPVAEEENAEKTKPVDTLIVKED
NDFSGLYYRGAAVVTPVFSLRTKASCGCGEFLDLKKVVDWCNITGLSLIQTLPVNDTTVY
FTWRDSYPYNPNSVQALHPMYLRLSSLTEDPEILAEINSVAQKLNALEQIDYEAVLKEKE
TITRKIFSKVGTTQKGFDEFKKNAGKWLIPYCVYRALIKSVDTPLPPTPKDFAEVEAMYA
ANKAECDYYAFVQYNLHLQLKEASDYAADHKVALKGDLPIGVSKRSVECWMYPNLFHLDK
STGAPPDYFSAGEGQNWGFPTYNWDNMAKDDYAWWKGRLSQMSQYFNAYRIDHILGFFRI
WAIPAIHRTGLLGRFSPDLPFSRQELEGYGIYDTDRLSYPYIRDHTLDSLFGDEKNFVIS
KFLVNNYNGTYNLKPEFQSEGAILEKTGLSPQFRESDKKIVNGLKLLLQNVCLIRDEQNP
NLFVPRIDMEKTYSSFNELDHWVQEGLKRLYNDYFYKRHEGLWEATARKRLPAMARASNM
LVCGEDLGMVPDCVVRVMNDMKINCLRIQRLTDTPNTLFYHPADYQYLTVSAPSGHDMST
IRGWWEEDRYKTQYFWEHLLGRSGAAPFTCPIDAVKTIFDMHLYGPAMLACFPLQDILSL
KLKYIEGRDPKLEQINDPSNPIHYWRYRCHVDMDEIIADNDLNNELRTAVEKSGRHLF
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggtctttatcaccattcattatagcactccatttggacaagcagtttgtctcgaagtt
tcaggagaaaaaaagttatataaattgaactatgttgataataacacatggtcaggagaa
gttgcatttgcatcaactggtcttattaattatcgttatcttattacaaaagaagatgat
ttaacagaaatctttagaactgaaggatcaaaagaatcatatccacactttcttgattta
actaacttgaaaagctttggtaaagtagaagttaatgatatttttatttcaggatttgat
gctgaagatactttcttaactacttcttatttcagaaaagttatttatggtaaaagacaa
gaagaaaaactttcaattaagaaattaggtcaaactactcttcttcttaaggttagatgt
acttgtgttccagaaggtcaatgtgtatttgttggtggtgctattgaatctcttggtaaa
tgggatgtttctaaagctattaaaatgacaccaacccatgttccatattatgaagccctt
attgatatttctaatgaaactgcttcttttgaatataagtgtttcattgctgatgctaac
tcacgtactaatgctagatgggaagatagatctaatagagtttattacattgctccagtt
gctgaagaagaaaatgcagaaaaaactaaaccagttgatactcttattgtaaaagaagat
aacgattttagtggactctattatagaggagctgctgttgttactccagtattctcactt
agaactaaagcatcatgtggatgtggtgaattccttgatttgaaaaaagttgttgattgg
tgtaacattactggattatcattaattcaaacccttccagttaatgatactactgtttac
tttacttggagagattcttatccatacaatccaaattcagtacaagcccttcatccaatg
tatcttagacttagttcattaactgaagacccagaaattcttgctgaaattaactcagtt
gcacaaaaacttaatgctttagagcaaattgactatgaggctgtccttaaagaaaaagaa
acaattacaagaaaaatattctcaaaagttggaactactcaaaagggatttgacgaattc
aaaaagaatgctggtaagtggttaattccatattgtgtttatcgtgctcttattaaatca
gttgatacaccattaccaccaacaccaaaagactttgctgaagttgaagctatgtatgct
gctaacaaagcagagtgtgattactatgcttttgtccaatacaatcttcatttacaactt
aaagaagctagtgactatgctgctgaccataaggttgcattaaaaggagatcttccaatt
ggagtttcaaagagatctgttgaatgctggatgtatccaaatcttttccatcttgataaa
tcaactggagcaccacctgactacttctcagctggtgaaggacaaaattggggattccca
acatataattgggataatatggctaaggatgattatgcttggtggaaaggaagattatct
caaatgtcacaatatttcaatgcatacagaattgatcatattcttggattctttagaatt
tgggctattcctgctattcatagaactggtcttcttggtagattctctcctgatttacca
ttttctagacaagaacttgagggatatggcatttatgatactgatagattaagttatcca
tatatcagagatcatactttagacagtctctttggtgatgaaaagaactttgttatttca
aaattccttgttaataattataacggaacttataacttaaaaccagaattccaaagtgaa
ggtgctatccttgaaaagactggactctctccacaatttagagaatcagataaaaaaatt
gttaatggacttaaacttctcttacaaaatgtatgtttgattagagacgaacaaaatcca
aatttgtttgttccaagaattgatatggaaaaaacatattctagcttcaatgaacttgat
cactgggtacaagaaggtcttaagagattatataatgattacttctataagagacatgaa
ggtctttgggaagctactgctagaaagagacttccagctatggctagagcttctaatatg
cttgtttgtggtgaagatcttggaatggttccagactgtgttgttagagtaatgaacgat
atgaaaattaattgtttgagaattcaaagattaactgatactccaaatactcttttctat
catccagctgactatcaataccttactgtctcagctccatctggacatgatatgtcaact
attcgtggatggtgggaagaagacagatataagactcaatatttctgggaacatcttctt
ggaagatctggagctgcaccatttacttgtcctattgatgccgttaaaactatctttgat
atgcatttgtatggaccagctatgcttgcttgtttcccacttcaagatattctttcactt
aaacttaagtatattgaaggacgtgatccaaaattagaacaaattaatgacccatccaat
ccaatccattactggagatatagatgccatgttgacatggacgaaattattgctgacaat
gatttgaacaatgaacttagaactgctgttgaaaaatctggcagacaccttttctaa

DBGET integrated database retrieval system