KEGG   Entamoeba dispar: EDI_198920Help
Entry
EDI_198920        CDS       T01083                                 

Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform (EC:2.7.1.153)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
edi  Entamoeba dispar
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Amoebiasis
Brite
KEGG Orthology (KO) [BR:edi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EDI_198920
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    EDI_198920
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    EDI_198920
Enzymes [BR:edi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     EDI_198920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 1047 aa AA seqDB search
MKKSVHSSVVNSQSQGSIVHVFIRHEGEIHSFTYSSTVSPLDIIDSIKSTLHLTGVYSVV
VPNIPFKIVDSMEGSEVKETGFYKSCIEYGIIPAFELVERSQAEKYESVGTLAKLMNQLK
ENYRIIGQTYVDVLSTDAEEIFVFRRSLARTRVLSSKIEAKYDSNLKEENEFAYTLSEPN
IPDTIKSIDVEIIGEDYKTTAVFTITPQVFVHRVIDSAFHELKKAGEDAVKGNEPTEYIL
KVVGWDEYIVPQRVNGKNWLLSDFDYIRRCALHGEPIHLELVKKSRLFSCKINDEERRVL
NYLDSFFASELWEAFDDEKRVSQRLCTDQLSAQVVSVENLYSYIKTKKGEEEEQQMVTDF
LCYFKVELYYGEKPLCPALYSTVFEVKNGLASPKWKFTFIQLIATLPAETKMIYSVYMTN
SIVNTQIEKIGENDKCLGTVNTKIVNYTNDLLNGEQQYYLWASEPNPIAMCCNAVSSKMK
VVVEFPSLTKPIRMDTYITKKKEMQVELEQESGKKMTVEELDAFKKIVDADAMAVFTQEE
LKCLWERRHSLLKTNPHALARLLNSVNYCQPTEVHELHRLLSKWPLLDPQEAIELLDFRY
PDPQIRGFALRCIDTMTDDQLVMYLPQLVQALKFELHHHSTLASFLLERSLKNRRRIGHN
LFWFLKAEIHDARVTGRYGVLMEAFLNGCGKYKNELEKEVTFQNELVVIANEVKQLGTKD
EQKAHLKSSLAKLEYPDEMSLPLDARFRFKKPVPNTGNVFSSKKKPLMLVLENADPLGEP
IMVIQKVGDDLRQDILTLQMIRLMNAIWKNNGLDLCMLPYLCIATGNEIGMLELVKNSET
YGAIMAMDKSKFSVIKDTAVTTWIKEQCARPESPVTFQEAVENFTYSCAGYCVATYILGI
GDRHSDNVMITRDGKFFHIDFGHFLGNFKSKFGVKRERTPFKFTQHFANVLGGKGAPQFV
KFEEICMNAFIIIRKHGPLFIYLFRLMLATGIPELQSAKDIEYMRNMFMFDKNDDEAKEA
FRQLIYKCLDAWSQTVNDLIHDFVHYK
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtctgttcattcatcagtagttaattcacaatcacaagggtctattgttcat
gtgtttattcgacacgaaggtgaaatacattcatttacatattcatctactgtatctcca
cttgatattatagacagtattaaaagtacactgcatttgactggagtttatagtgttgtt
gttcctaatattccgtttaagattgttgattctatggaaggttcagaagtgaaagagaca
gggttttataagtcatgtattgaatatggaattattcctgcttttgaactagttgagaga
agtcaagcagaaaaatatgagagtgttggaacattagcaaaattaatgaatcaattaaaa
gagaattatcgaatcattggacaaacatatgttgatgtattaagcactgatgcagaagaa
atatttgtatttagaagatcacttgcaagaacacgtgtattgtcaagtaaaatagaagct
aaatacgattctaatttaaaagaagaaaacgagtttgcttatacattaagtgaacctaat
atacctgatactattaaaagtattgatgttgaaattattggagaagactataaaactaca
gcagttttcacaattactccacaagtatttgttcatagggttattgattctgcttttcat
gaattaaagaaagcaggagaagatgcagttaaaggaaatgaaccaacagaatatatctta
aaagtagttggatgggatgaatacattgtaccacaacgtgttaatggaaagaattggtta
ttgagtgattttgattatataagaagatgtgcgttacatggggaaccaattcatttagaa
ttagttaaaaaaagtcgattattttcatgtaaaattaatgatgaagaaagaagagtctta
aattatcttgattccttttttgcatcagaattatgggaagcatttgatgatgaaaaaaga
gtctcacaaaggctttgtacagaccaattaagtgcacaagttgtttctgtagagaattta
tattcttatattaaaacaaaaaaaggagaggaagaagagcaacaaatggttactgatttt
ctttgttattttaaagtagagttatattacggagaaaagccattatgtccagcactatat
tcaacagtttttgaagttaaaaatggattagcctctcctaagtggaaatttacttttatt
caattaattgctacactcccagctgaaacaaaaatgatttattcagtgtatatgactaat
tcaatagttaatacccaaatagaaaagattggtgaaaatgataaatgtcttggaacagtg
aatacgaaaatcgttaattatacaaatgatttactaaatggtgaacaacagtactattta
tgggcaagtgaaccaaatccaattgctatgtgttgtaatgcagtaagttcaaagatgaaa
gttgttgttgaatttccatcattaactaaaccaatcagaatggatacatatatcactaag
aaaaaagaaatgcaagtagagttagaacaagaatcaggaaaaaaaatgactgttgaagaa
ttagatgcatttaaaaaaatagttgacgctgatgctatggctgtatttactcaagaagaa
ttaaaatgtttatgggaaagaagacattctttattaaaaacaaatccacatgcccttgct
cgtttattgaactctgttaattattgccaaccaacagaagtacatgagttacatagatta
ttaagcaaatggccattattagatcctcaagaagctattgagttattagattttagatac
ccagaccctcaaataagaggttttgctttacggtgtattgatactatgactgatgaccaa
ttagtaatgtatttacctcaactagttcaagcattaaaatttgagttacatcatcattct
acactagcatcatttttgttggaaaggtcattaaagaatagaagaagaattgggcataat
ttgttttggtttttaaaagcagaaattcatgatgccagagtcactggaaggtatggtgtt
ttgatggaagcattcttaaatggatgcggaaaatataaaaatgaattagaaaaagaagtt
acgttccaaaacgaattagttgttatcgccaatgaagtaaaacaacttggaacaaaagat
gagcagaaagctcatttaaagagttcattagcaaaattagaatatcctgatgaaatgtct
ttaccattggatgcaaggtttagatttaaaaaaccagttccaaacactggaaatgtattt
agtagtaaaaagaaaccattgatgttggtattagaaaatgcagatccattaggagaaccg
attatggttattcaaaaagttggtgatgatttaagacaagatatcttaactttacaaatg
ataagattaatgaatgctatttggaaaaataatggtcttgatttatgcatgttaccatac
ctttgcattgccacaggaaatgaaataggaatgttagaacttgttaaaaattcagaaaca
tatggagcaattatggctatggacaaaagtaaatttagtgttattaaagatactgcagta
actacttggattaaagaacaatgtgcccgtccagaaagtccagtaacattccaagaagca
gtagaaaactttacttattcatgtgcaggatattgtgtagcaacatacattttaggtatt
ggagatagacatagtgacaacgtaatgattactcgagatggtaaattcttccatattgat
tttggacattttcttggtaattttaaatcaaaatttggagttaaaagagaaagaacacca
tttaaatttactcaacactttgctaatgttcttggaggtaaaggagctccacaatttgtt
aaatttgaagaaatttgtatgaatgcttttatcattataagaaaacatggtccattgttt
atttatttatttaggttaatgcttgctacaggtattcctgaattacaaagtgccaaagat
attgaatatatgagaaatatgttcatgtttgataaaaatgatgatgaggctaaagaggcg
tttagacaactcatttataagtgtcttgatgcttggtctcaaactgttaatgatttgatt
catgacttcgtacattataaatga

DBGET integrated database retrieval system