KEGG   Entamoeba dispar: EDI_202520Help
Entry
EDI_202520        CDS       T01083                                 

Definition
TFIIH basal transcription factor complex p52 subunit (EC:3.5.1.49)
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
edi  Entamoeba dispar
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:edi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    EDI_202520
  Replication and repair
   03420 Nucleotide excision repair
    EDI_202520
Transcription machinery [BR:edi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     EDI_202520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
AA seq 489 aa AA seqDB search
MENNIIEKDIIKYFQVLPEIAMKSAYKSKWTCSEIFRLLPGMCQSLLLRIIFLKERITIH
ELYNQFKIPNETMDEVINTIHSIHIIDKEEENGILYIKLNNDFQNNFKMNLIGSMEPAYK
IKEVNEKVSQIIKEKCLKENCIKTFEYFMNKLLQFNSQPNISNNPLRIFKDLELVKEETR
QITRKGYQFLFQETKTQLWVIMLSIIGLIQRRISPFINDVFEMTYLKENIIYNCDRFKKV
YGPDPLQLFNDLGIIVYYKEQNVMAITPLMSLLRSNANIPSDLVKKPKTITEINYSVYIY
TESQFQVDLYRLFIRKNFQLANLWVGKLNHQSVTEAFAKGITSEMLINFLQPNLPRTIQK
QIDLWKKEINRFKEEHVVRYKFYDDAIGRQLFIIVKNESDRLKATILEKEDIRLIFVKYQ
YGETIRSFMKKKERELLLKQPHPSSTSVPLSLSTDNDSKILSKNNTHSGIKRSVPEGVKP
KPSKKYIVD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatataatagaaaaggacattattaaatattttcaagttttaccagaaata
gccatgaaatcagcatataaatcgaaatggacatgttcagaaatatttcggttattacct
gggatgtgtcaaagtttgttattaagaattatttttctaaaggaaagaatcactatacat
gaattgtataatcaatttaaaataccaaatgaaacaatggacgaagtgattaatacaatc
catagcattcacattattgataaagaagaagaaaatggaattttgtatattaaactaaat
aatgactttcagaataattttaaaatgaatcttataggatcaatggaaccagcatataaa
attaaagaagttaatgaaaaagtatcacaaataattaaagagaaatgtttaaaagaaaat
tgtattaaaacatttgaatattttatgaataaattacttcaatttaatagtcaaccaaat
atttcaaataatccattaagaatatttaaagatttggaattagttaaagaagaaactaga
caaataactcgaaaaggataccaatttttatttcaagaaacaaaaacacaactttgggtt
attatgcttagtattattggtcttattcaaagaagaatatcaccatttattaatgatgtt
tttgaaatgacatatttaaaagaaaacattatttataattgtgatcgttttaaaaaagta
tatggaccagatccacttcaattatttaacgaccttggtattattgtatattataaagaa
caaaatgttatggcaattacaccgttaatgtctctacttcgatcaaatgctaatattcca
agtgaccttgtaaaaaaacctaaaacaataactgaaattaattattctgtttatatttat
acagagagtcaatttcaagttgatttatatagattatttattagaaagaatttccaatta
gctaatttatgggttggaaaacttaatcatcaatcagtaacagaagcatttgcaaaaggt
attactagtgaaatgttaattaatttcttacaaccaaatttacctcgaaccattcaaaaa
caaattgatttatggaaaaaagaaataaatcgatttaaagaagaacatgtagttcgttat
aaattttatgatgatgcaattggaagacaattatttattatagttaaaaatgaaagtgat
agattaaaagcaacgatattagaaaaagaagatattagattaatatttgtaaaatatcag
tatggagaaactattaggtcatttatgaaaaagaaagaaagagaacttttattaaaacaa
ccacatccttcttctacttctgttcctctttcattatcaactgataatgattctaaaata
ctttcaaaaaataatactcattcaggtattaaaagaagtgttcctgaaggagtaaaaccc
aaaccatcaaagaaatacattgttgattga

DBGET integrated database retrieval system